MuerBT磁力搜索 BT种子搜索利器 免费下载BT种子,超5000万条种子数据

Busy Teacher

磁力链接/BT种子名称

Busy Teacher

磁力链接/BT种子简介

种子哈希:b5869b8748aec2bd32f612d19ca6dcc4e8bdcbb2
文件大小: 4.9G
已经下载:1129次
下载速度:极快
收录时间:2017-02-25
最近下载:2026-06-06
DMCA/投诉/Complaint:DMCA/投诉/Complaint

移花宫入口

移花宫.com邀月.com怜星.com花无缺.comyhgbt.icuyhgbt.top

磁力链接下载

magnet:?xt=urn:btih:B5869B8748AEC2BD32F612D19CA6DCC4E8BDCBB2
推荐使用PIKPAK网盘下载资源,10TB超大空间,不限制资源,无限次数离线下载,视频妻友

下载BT种子文件

磁力链接 迅雷下载 PIKPAK在线播放 世界之窗 91短视频apk 含羞草 欲漫涩 逼哩逼哩 快手视频 51品茶 萝莉岛APP 51动漫 91短视频 AI色色 91porn视频 TikTok成人版 Pornhub中文版 暗网Xvideo 禁漫天堂 P站专业版 海角乱伦 萝莉岛 海角 妻友

最近搜索

vs v sofia bandar oracle+database+patch il doris ccc ejaculation 强推哥【jamal060913】编号31完整版:内射排卵期少妇 curious.case.of.benjamin.button. bbf 秦时明月 유출 coding 知b g tastf 表妹 南韩21岁大二美女jojo dark+side scary movie gachi+644 175-240期大尺度套图版+超清原版+极品粉嫩蝴蝶小穴+pans超人气模特+佳琪 leezy 333 诗时君君 大神++合集 green茶茶酱 ava addams pov v4

文件列表

  • ODP/relationships.odp 379.4 kB
  • ODT/activities-tracing.odt 11.8 kB
  • ODT/answers-sport-at-heart.odt 12.4 kB
  • ODT/auxillary-verbs.odt 18.4 kB
  • ODT/beyonc.odt 169.3 kB
  • ODT/bullying-listening-why-do-people-bully-and.odt 17.8 kB
  • ODT/composite-questions.odt 21.3 kB
  • ODT/compound-nouns-ws.odt 7.6 kB
  • ODT/corrig-why-take-a-gap-year-bts.odt 14.6 kB
  • ODT/corrige769-why-take-a-gap-year-bts.odt 14.6 kB
  • ODT/countries.odt 15.5 kB
  • ODT/end-of-the-world-1.odt 593.2 kB
  • ODT/fill-in-the-verbs.odt 12.7 kB
  • ODT/future-perfect-and-continuous.odt 20.0 kB
  • ODT/gatsby-quiz.odt 12.8 kB
  • ODT/happy-birthday-in-a-cutting-edge-style.odt 117.4 kB
  • ODT/hey-there-copia.odt 102.4 kB
  • ODT/how-do-you-read-3.odt 23.0 kB
  • ODT/it-will-rain-bruno-mars.odt 104.1 kB
  • ODT/modal-verbs-explanation-and-exercise.odt 40.5 kB
  • ODT/money-makes-the-world-go-round.odt 271.4 kB
  • ODT/mum-not-eating-1.odt 23.4 kB
  • ODT/names-of-months-and-days.odt 859.4 kB
  • ODT/phonological-exercise.odt 17.5 kB
  • ODT/Phonological_exercise.odt 17.5 kB
  • ODT/placement-quiz-a2-to-b2.odt 14.9 kB
  • ODT/prepa-sequence-1-s233quence-dintro-1h.odt 24.5 kB
  • ODT/present-perfect-question-tags.odt 25.7 kB
  • ODT/present-simple-and-continuous.odt 14.1 kB
  • ODT/presentationheshe.odt 22.3 kB
  • ODT/queen-show-must-go-on.odt 16.7 kB
  • ODT/read-and-solve-the-biograpy-puzzle-ex.odt 57.9 kB
  • ODT/reading-activity.odt 37.2 kB
  • ODT/relative-clauses.odt 18.3 kB
  • ODT/school-shooting-in-newtown-term.odt 14.1 kB
  • ODT/sheet-enviar.odt 10.3 kB
  • ODT/shopping-situations.odt 14.7 kB
  • ODT/Shopping_Role_Plays.odt 7.5 kB
  • ODT/simple-present.odt 12.4 kB
  • ODT/sir-arthur-conan-doyle.odt 80.1 kB
  • ODT/social-networks.odt 14.7 kB
  • ODT/song-listening-comprehension-pink-just-give-me-a.odt 106.2 kB
  • ODT/space-pics-vocab-elementary.odt 1.4 MB
  • ODT/submarine.odt 7.9 kB
  • ODT/suitcase-game_hawaii.odt 104.2 kB
  • ODT/te-unit-2-would-you-like-to.odt 639.3 kB
  • ODT/teens.odt 261.1 kB
  • ODT/teens_001.odt 234.8 kB
  • ODT/tell-me-about-your-last-vacation.odt 13.7 kB
  • ODT/the-big-bang-theory-episod-1-season-1.odt 170.5 kB
  • ODT/the-simpsons-video-activity-easy.odt 35.1 kB
  • ODT/the-simpsons-video-activity.odt 35.9 kB
  • ODT/traditional-foods.odt 246.5 kB
  • ODT/wg-part-1.odt 155.3 kB
  • ODT/what-is-that-animal.odt 527.3 kB
  • ODT/whquestionwords.odt 1.1 MB
  • PDF/-ed-or-ing-adjectives.pdf 51.7 kB
  • PDF/-ing-adjectives.pdf 763.7 kB
  • PDF/-s-ed.pdf 76.9 kB
  • PDF/01-adele-someone-like-you-worksheet.pdf 57.6 kB
  • PDF/0439503752_e057.pdf 189.5 kB
  • PDF/0439503752_e058.pdf 179.3 kB
  • PDF/0439503752_e059.pdf 173.1 kB
  • PDF/0439503752_e060.pdf 171.1 kB
  • PDF/0439503752_e061.pdf 179.8 kB
  • PDF/0439503752_e062.pdf 177.0 kB
  • PDF/0439503752_e063.pdf 186.8 kB
  • PDF/0439503752_e064.pdf 195.8 kB
  • PDF/0439503752_e065.pdf 172.4 kB
  • PDF/0439503752_e066.pdf 177.9 kB
  • PDF/0439503752_e069.pdf 199.8 kB
  • PDF/0439503752_e070.pdf 164.2 kB
  • PDF/0439503752_e071.pdf 211.3 kB
  • PDF/0439503752_e072.pdf 194.4 kB
  • PDF/0439503752_e073.pdf 161.8 kB
  • PDF/0439503752_e074.pdf 194.9 kB
  • PDF/0439503752_e075.pdf 164.2 kB
  • PDF/0439503752_e089.pdf 159.2 kB
  • PDF/0439503752_e091.pdf 191.1 kB
  • PDF/0439503787_e035.pdf 185.6 kB
  • PDF/0439503787_e036.pdf 184.8 kB
  • PDF/0439504112_e013.pdf 177.6 kB
  • PDF/0439553687_e032.pdf 289.9 kB
  • PDF/0439731933_e001.pdf 1.6 MB
  • PDF/0439731933_e003.pdf 130.5 kB
  • PDF/0439863120_e003.pdf 1.8 MB
  • PDF/1-2-3-4.pdf 200.4 kB
  • PDF/1-2-3-smiley-faces.pdf 12.8 kB
  • PDF/1-2-conditionals.pdf 570.6 kB
  • PDF/1-conditional-review.pdf 264.7 kB
  • PDF/1-first-conditional-part-one-presentation-and.pdf 100.2 kB
  • PDF/1-harry-potter-and-the-sorcerers-stone.pdf 52.3 kB
  • PDF/1-net.pdf 608.3 kB
  • PDF/1.pdf 2.8 kB
  • PDF/10-american-icons-that-aren.pdf 1.9 MB
  • PDF/10-apostrophe-errors.pdf 518.9 kB
  • PDF/10-ways-to-be-a-good-student-poster.pdf 860.6 kB
  • PDF/1001-arabian-nights.pdf 225.1 kB
  • PDF/103-things-to-do-before-during-after-reading.pdf 94.1 kB
  • PDF/10329.pdf 595.9 kB
  • PDF/10g.pdf 493.1 kB
  • PDF/10suns.pdf 303.3 kB
  • PDF/1186bach-reported-speech.pdf 75.0 kB
  • PDF/12 Months in a Year.pdf 212.0 kB
  • PDF/12 Sports.pdf 218.0 kB
  • PDF/12-powerful-words_review.pdf 102.3 kB
  • PDF/12-powerfulword-quiz.pdf 20.9 kB
  • PDF/13_countable_and_uncountable_nouns.pdf 47.3 kB
  • PDF/13_countable_and_uncountable_nouns_001.pdf 47.3 kB
  • PDF/15-grammar-rules.pdf 5.5 MB
  • PDF/17-pages-graded-dictations.pdf 116.6 kB
  • PDF/1_001.pdf 3.6 MB
  • PDF/1c-adjectives-to-describe-feelings.pdf 203.9 kB
  • PDF/1c-foods-and-their-origins.pdf 1.1 MB
  • PDF/1gift.pdf 227.2 kB
  • PDF/1m-prueba-coef.pdf 55.3 kB
  • PDF/1st-cond-famous-sights.pdf 444.3 kB
  • PDF/1st-conditional.pdf 38.9 kB
  • PDF/2-b-famous-families.pdf 1.5 MB
  • PDF/2-present-2-pasts-present-perfect.pdf 439.6 kB
  • PDF/2.pdf 39.8 kB
  • PDF/2007_031.pdf 59.6 kB
  • PDF/20100215-you-cant-be-captain-integrated.pdf 1.7 MB
  • PDF/2012-005-03-draw-and-color-shapes.pdf 79.4 kB
  • PDF/2012-modal-verb-practice.pdf 106.9 kB
  • PDF/2186eso-grammarvocabulary-12.pdf 53.8 kB
  • PDF/2186eso-readinglisteningwriting-12.pdf 43.8 kB
  • PDF/25-classroom-verbs.pdf 1.2 MB
  • PDF/27134930.pdf 10.1 kB
  • PDF/2bachexerc.pdf 44.0 kB
  • PDF/2nd-conditional-cards.pdf 18.9 kB
  • PDF/2nd-conditional-ppttt.pdf 349.8 kB
  • PDF/2ndconditional_grenade.pdf 396.7 kB
  • PDF/2ndgrread2.pdf 191.7 kB
  • PDF/3-sisters.pdf 92.6 kB
  • PDF/3-the-first-conditional-interrogatives.pdf 70.8 kB
  • PDF/3.pdf 231.1 kB
  • PDF/30-irregular-verbs.pdf 1.3 MB
  • PDF/30.pdf 100.0 kB
  • PDF/3186c-2nd-term2012.pdf 36.3 kB
  • PDF/387_conversation-starterstop-501.pdf 59.2 kB
  • PDF/3c-st-immigration-uk-1.pdf 219.6 kB
  • PDF/3letterfrequentwords.pdf 18.2 kB
  • PDF/3rd-form-group-work.pdf 150.1 kB
  • PDF/4-july-uncle-sam.pdf 164.1 kB
  • PDF/4-rooms.pdf 17.7 kB
  • PDF/4-said-i-loved-you-but-i-lied.pdf 162.6 kB
  • PDF/4-seasons.pdf 418.9 kB
  • PDF/4.pdf 220.2 kB
  • PDF/4_have_you_ever-questionnaire.pdf 92.7 kB
  • PDF/4_have_you_ever_questionnaire.pdf 92.7 kB
  • PDF/4_have_you_ever_questionnaire_001.pdf 92.7 kB
  • PDF/4_have_you_ever_questionnaire_002.pdf 92.7 kB
  • PDF/4_have_you_ever_questionnaire_003.pdf 92.7 kB
  • PDF/4_have_you_ever_questionnaire_004.pdf 92.7 kB
  • PDF/4_have_you_ever_questionnaire_005.pdf 92.7 kB
  • PDF/4_have_you_ever_questionnaire_006.pdf 92.7 kB
  • PDF/4_have_you_ever_questionnaire_007.pdf 92.7 kB
  • PDF/4_have_you_ever_questionnaire_008.pdf 92.7 kB
  • PDF/4seasons-poster.pdf 349.0 kB
  • PDF/4tenses.pdf 37.2 kB
  • PDF/4th-game.pdf 886.4 kB
  • PDF/4th-july-finder-puppets.pdf 61.8 kB
  • PDF/4th-july-parade.pdf 71.9 kB
  • PDF/4th-july-puppet.pdf 36.7 kB
  • PDF/4th-july-visor.pdf 101.0 kB
  • PDF/50-dates.pdf 234.8 kB
  • PDF/500-hats.pdf 111.6 kB
  • PDF/50117s.pdf 1.6 MB
  • PDF/50691s.pdf 381.8 kB
  • PDF/50firstdates-movieworksheet.pdf 144.9 kB
  • PDF/576_the-mistery-of-wales.pdf 73.8 kB
  • PDF/5th-has-vs-have-grammar-sheet-to-share.pdf 43.6 kB
  • PDF/5to_ingles_004.pdf 300.4 kB
  • PDF/5to_ingles_retroalimentacion-unit-4.pdf 373.1 kB
  • PDF/5to_inlges_writing-numbers-1-20.pdf 429.0 kB
  • PDF/5tobas_ingles_002.pdf 201.1 kB
  • PDF/5tobas_ingles_003.pdf 372.0 kB
  • PDF/6-minutes-english-arachnophobia.pdf 97.0 kB
  • PDF/6-ways-2-use-icecream-cones.pdf 46.9 kB
  • PDF/60-second-science-worksheets-sleep-habits.pdf 193.8 kB
  • PDF/6186primary.pdf 112.4 kB
  • PDF/6bas_ingles_-remedial-unit-3.pdf 449.7 kB
  • PDF/6bas_ingles_-retroalimentacion_15-06.pdf 511.2 kB
  • PDF/6tobas_ingles_describing.pdf 1.2 MB
  • PDF/7-things-miley-cyrus.pdf 240.1 kB
  • PDF/7th-grades-level-test.pdf 75.1 kB
  • PDF/8-2-grammar-1.pdf 54.2 kB
  • PDF/8-verb-tenses.pdf 82.7 kB
  • PDF/8th-f.pdf 97.0 kB
  • PDF/913-923933922917921927.pdf 124.5 kB
  • PDF/93-million-miles-from-the-sun-easier-version.pdf 119.5 kB
  • PDF/93-million-miles-song-activity.pdf 53.1 kB
  • PDF/99_ways_very_good.pdf 88.0 kB
  • PDF/_pre-intermediate__tests-k-yunitam-raspechatat-s-6.pdf 684.3 kB
  • PDF/A Very Sad Word Puzzle.pdf 217.7 kB
  • PDF/a-an-some-any-g.pdf 57.2 kB
  • PDF/a-an-the.pdf 419.0 kB
  • PDF/a-an.pdf 563.1 kB
  • PDF/a-any-some.pdf 1.7 MB
  • PDF/a-big-dinner.pdf 278.2 kB
  • PDF/a-brief-history-of-tourism.pdf 241.8 kB
  • PDF/a-call-for-improved-national-crisis-management.pdf 94.6 kB
  • PDF/a-christmas-carol-questions.pdf 22.4 kB
  • PDF/a-christmas-carol-video-comprehension-worksheet.pdf 695.3 kB
  • PDF/a-conjunction.pdf 338.1 kB
  • PDF/a-cup-of-kindness.pdf 243.7 kB
  • PDF/a-day-out.pdf 369.4 kB
  • PDF/a-farmer.pdf 63.8 kB
  • PDF/a-few-of-my-favourite-things.pdf 189.4 kB
  • PDF/a-ghost-story.pdf 223.0 kB
  • PDF/a-job-well-done.pdf 217.8 kB
  • PDF/a-large-area-of-your-country-has-been-set-aside.pdf 22.8 kB
  • PDF/a-little-a-few.pdf 309.9 kB
  • PDF/a-little-time-tag-questions.pdf 35.8 kB
  • PDF/a-mirror-before-your-very-eyes.pdf 808.4 kB
  • PDF/a-new-copy.pdf 126.1 kB
  • PDF/a-new-place.pdf 517.3 kB
  • PDF/a-new-start.pdf 51.9 kB
  • PDF/a-or-an.pdf 255.9 kB
  • PDF/a-pizza.pdf 163.8 kB
  • PDF/a-scary-story.pdf 130.6 kB
  • PDF/a-short-history-of-the-fork.pdf 982.9 kB
  • PDF/a-strange-meal.pdf 58.1 kB
  • PDF/a-true-friend-alphabet-entries.pdf 160.4 kB
  • PDF/a-visit-to-the-doctor-students-a-b.pdf 183.1 kB
  • PDF/a-visit-to-the-farm.pdf 126.8 kB
  • PDF/a-wonderful-day.pdf 151.4 kB
  • PDF/a-year-full-of-themes-pgs-77-83.pdf 238.0 kB
  • PDF/a-z-flashcards.pdf 90.7 kB
  • PDF/a-z-race-correct-grammar-mistakes.pdf 169.9 kB
  • PDF/a_christmastrivia_quiz.pdf 275.7 kB
  • PDF/abcedario.pdf 1.5 MB
  • PDF/abcsofmebooklet.pdf 66.2 kB
  • PDF/about-women-make-the-news-with-multiple-choice.pdf 81.0 kB
  • PDF/academic.pdf 193.2 kB
  • PDF/acceptable-public-conduct-in-germany-naus.pdf 222.0 kB
  • PDF/acceptance_speech_activity.pdf 59.5 kB
  • PDF/ACHES AND PAINS.pdf 218.1 kB
  • PDF/aches-pains-matching.pdf 69.2 kB
  • PDF/aches-pains.pdf 617.6 kB
  • PDF/achievement.pdf 165.4 kB
  • PDF/across-america.pdf 958.9 kB
  • PDF/actiion-verbs-crossword.pdf 264.5 kB
  • PDF/action-verbs-1-worksheet-criss-cross-puzzl.pdf 881.7 kB
  • PDF/action-verbs.pdf 347.6 kB
  • PDF/actions-1.pdf 914.4 kB
  • PDF/actions-and-movements-1.pdf 582.1 kB
  • PDF/actions-and-movements-2.pdf 544.4 kB
  • PDF/actions-and-movements-matching1.pdf 592.1 kB
  • PDF/actions-and-movements-matching2.pdf 574.8 kB
  • PDF/actions-and-movements-matching3.pdf 704.0 kB
  • PDF/actions-and-movements-matching4.pdf 400.9 kB
  • PDF/actions-flashcards.pdf 1.8 MB
  • PDF/actions.pdf 1.3 MB
  • PDF/active-expressions.pdf 112.9 kB
  • PDF/active-or-passive-present-continuous.pdf 185.7 kB
  • PDF/active-or-passive-present-perfect.pdf 177.0 kB
  • PDF/active-or-passive-present-simple.pdf 204.6 kB
  • PDF/active-or-passive-three-texts.pdf 97.7 kB
  • PDF/active-or-passive.pdf 101.1 kB
  • PDF/active_adjectives.pdf 140.0 kB
  • PDF/active_adjectives_001.pdf 140.0 kB
  • PDF/activeenergy_primelem.pdf 252.1 kB
  • PDF/actividad-final-arnold.pdf 166.9 kB
  • PDF/actividad-final-arnold_001.pdf 166.9 kB
  • PDF/activities.pdf 3.6 MB
  • PDF/activities_speech-chain.pdf 84.2 kB
  • PDF/activity-1-present-continuous.pdf 160.1 kB
  • PDF/activity-movie.pdf 85.0 kB
  • PDF/activity-present.pdf 326.9 kB
  • PDF/adding-ion.pdf 37.4 kB
  • PDF/adding-sion.pdf 34.3 kB
  • PDF/adele-dont-you-remember-by-adele-students2.pdf 75.5 kB
  • PDF/adele-rolling-in-the-deep-350ark305-s246z252.pdf 58.0 kB
  • PDF/adele-set-fire-to-the-rain-activity.pdf 553.0 kB
  • PDF/adele-someone-like-you.pdf 70.1 kB
  • PDF/adele.pdf 190.4 kB
  • PDF/adj-syn.pdf 271.9 kB
  • PDF/adjective-formation-2012.pdf 135.0 kB
  • PDF/adjective-formation.pdf 306.1 kB
  • PDF/adjective-or-adverb.pdf 131.1 kB
  • PDF/adjective-word-search.pdf 220.0 kB
  • PDF/adjective.pdf 422.0 kB
  • PDF/adjective_001.pdf 144.1 kB
  • PDF/Adjective_Clauses_mod.pdf 507.8 kB
  • PDF/adjective_mind_map.pdf 16.6 kB
  • PDF/adjective_noun_basket.pdf 26.9 kB
  • PDF/Adjectives ending in ED.pdf 217.9 kB
  • PDF/adjectives-2.pdf 258.5 kB
  • PDF/adjectives-and-adverbs.pdf 52.8 kB
  • PDF/adjectives-circle-and-colour.pdf 167.6 kB
  • PDF/adjectives-ed-or-ing.pdf 192.4 kB
  • PDF/adjectives-of-comparison.pdf 50.8 kB
  • PDF/adjectives-sentence-structures.pdf 207.8 kB
  • PDF/adjectives-speaking.pdf 21.4 kB
  • PDF/adjectives-that-describe-feelings.pdf 220.2 kB
  • PDF/adjectives-their-opposites-2.pdf 218.2 kB
  • PDF/adjectives-their-opposites.pdf 271.8 kB
  • PDF/adjectives.pdf 713.9 kB
  • PDF/adjectives_001.pdf 76.4 kB
  • PDF/adjectives_002.pdf 192.0 kB
  • PDF/adjectives_003.pdf 437.5 kB
  • PDF/adjectives_004.pdf 301.5 kB
  • PDF/adjectives_005.pdf 269.5 kB
  • PDF/adjectives_006.pdf 219.7 kB
  • PDF/adjectives_007.pdf 1.2 MB
  • PDF/adjectives_008.pdf 72.8 kB
  • PDF/adjectives_009.pdf 47.9 kB
  • PDF/adjprep.pdf 15.8 kB
  • PDF/adjs-of-emotion.pdf 25.0 kB
  • PDF/ads-and-stereotypes-questions.pdf 78.7 kB
  • PDF/adv-the-british-vs-the-americans.pdf 112.2 kB
  • PDF/advanced-vocabulary-expressions-key.pdf 123.6 kB
  • PDF/adventure-travel_info-gap.pdf 418.2 kB
  • PDF/adventures-tests.pdf 3.3 MB
  • PDF/adverb-or-adjective-doctor-patient-joke-gap-fill.pdf 118.5 kB
  • PDF/adverb-or-adjective-doctor-patient-joke-powerpoint.pdf 85.2 kB
  • PDF/ADVERBS OF MANNER.pdf 216.1 kB
  • PDF/adverbs-adjective.pdf 252.8 kB
  • PDF/adverbs-of-different-meanings.pdf 35.8 kB
  • PDF/adverbs-of-frequency-set-2012.pdf 105.0 kB
  • PDF/adverbs-of-frequency.pdf 36.0 kB
  • PDF/adverbs-of-frequency_001.pdf 68.7 kB
  • PDF/adverbs-of-manner.pdf 35.8 kB
  • PDF/adverbs.pdf 11.9 kB
  • PDF/adverbs_001.pdf 11.9 kB
  • PDF/Adverbs_002.pdf 220.2 kB
  • PDF/adverbs_003.pdf 221.4 kB
  • PDF/adverbs_004.pdf 96.5 kB
  • PDF/adverbsfrequency.pdf 257.0 kB
  • PDF/advertising-techniques.pdf 1.3 MB
  • PDF/advertising.pdf 282.6 kB
  • PDF/advertising_001.pdf 6.2 kB
  • PDF/advice-please-you-should.pdf 29.1 kB
  • PDF/advice_column-clothing.pdf 198.6 kB
  • PDF/affirmation.pdf 274.7 kB
  • PDF/affixes.pdf 19.3 kB
  • PDF/africawordsearch.pdf 524.5 kB
  • PDF/After rain comes fine weather.pdf 218.9 kB
  • PDF/after-holiday-game-kn.pdf 51.9 kB
  • PDF/after-sales-complaint-cloze-test.pdf 38.6 kB
  • PDF/after_reading_activities.pdf 109.3 kB
  • PDF/agreeing-present-continous-health-likes-and.pdf 58.8 kB
  • PDF/agreement_between_verbs__prepositions.pdf 24.9 kB
  • PDF/agreement_between_verbs__prepositions_001.pdf 24.9 kB
  • PDF/ai-and-i.pdf 23.0 kB
  • PDF/ailments-and-injuries.pdf 945.8 kB
  • PDF/ailments-crossword.pdf 1.0 MB
  • PDF/Air Travel wordsearch.pdf 220.1 kB
  • PDF/airport-test.pdf 353.1 kB
  • PDF/alex-clare.pdf 209.4 kB
  • PDF/Alexander Graham Bell.pdf 217.9 kB
  • PDF/alfabet-ang.pdf 2.7 MB
  • PDF/alien-abduction_roleplay.pdf 57.4 kB
  • PDF/aliens.pdf 306.1 kB
  • PDF/All About Australia.pdf 220.2 kB
  • PDF/All About Coffee .pdf 216.3 kB
  • PDF/all-about-me-cards.pdf 838.7 kB
  • PDF/all-about-you.pdf 149.5 kB
  • PDF/all-about.pdf 322.5 kB
  • PDF/all-along-it-was-a-fever.pdf 82.0 kB
  • PDF/all-i-want-for-christmas-mariah-carry.pdf 120.8 kB
  • PDF/all-my-loving.pdf 36.6 kB
  • PDF/all-tenses-drill.pdf 5.4 kB
  • PDF/all-you-need-to-know-about-kitchen-and-cooking.pdf 66.3 kB
  • PDF/allaboutme.pdf 150.8 kB
  • PDF/allupabc.pdf 231.3 kB
  • PDF/alphabet-and-colours.pdf 517.1 kB
  • PDF/alphabet-for-kids.pdf 1.2 MB
  • PDF/alphabet-phonetic-transcription.pdf 2.8 MB
  • PDF/alphabet-ppt.pdf 934.9 kB
  • PDF/alphabet-wordsearch.pdf 56.5 kB
  • PDF/alphabet.pdf 15.3 kB
  • PDF/alphabet_001.pdf 241.0 kB
  • PDF/alphabet_002.pdf 884.6 kB
  • PDF/alphabet_coloring.pdf 637.2 kB
  • PDF/alphabetnumbers.pdf 52.6 kB
  • PDF/alphabetstep.pdf 221.6 kB
  • PDF/alphamaze_lower1.pdf 85.3 kB
  • PDF/alphamaze_upper2.pdf 77.6 kB
  • PDF/already-just-yet-before-worksheet.pdf 68.5 kB
  • PDF/Alternative sources of energy double puzzle.pdf 214.5 kB
  • PDF/although-even-though.pdf 22.2 kB
  • PDF/am-elections.pdf 127.8 kB
  • PDF/am-i-telling-the-truth.pdf 30.2 kB
  • PDF/amazingfactstoblowyourmind-2.pdf 49.7 kB
  • PDF/american-brit.pdf 710.8 kB
  • PDF/american-english.pdf 353.8 kB
  • PDF/american-flag.pdf 460.5 kB
  • PDF/american-high-schools.pdf 2.8 MB
  • PDF/american-pie.pdf 128.8 kB
  • PDF/amy-winehouse-you-know-im-no-good.pdf 785.4 kB
  • PDF/an English proverb.pdf 214.6 kB
  • PDF/an-ice-hotel.pdf 2.1 MB
  • PDF/angel-christmas.pdf 857.7 kB
  • PDF/angels-robin-willians-2.pdf 44.6 kB
  • PDF/angry-and-the-beanstalk.pdf 572.9 kB
  • PDF/ANIMAL WORD SEARCH.pdf 218.2 kB
  • PDF/animal-babies.pdf 324.1 kB
  • PDF/animal-bingo.pdf 819.3 kB
  • PDF/animal-classes.pdf 388.1 kB
  • PDF/animal-farm-vocab-quiz.pdf 90.0 kB
  • PDF/animal-presentation.pdf 3.6 MB
  • PDF/animal-qa.pdf 258.4 kB
  • PDF/animal-riddles.pdf 337.6 kB
  • PDF/animal.pdf 243.9 kB
  • PDF/animal_matching.pdf 863.8 kB
  • PDF/animal_worksheet.pdf 192.3 kB
  • PDF/animalfarm.pdf 203.6 kB
  • PDF/Animals Word Search.pdf 212.1 kB
  • PDF/Animals Word Search_001.pdf 203.8 kB
  • PDF/animals-bingo.pdf 831.3 kB
  • PDF/animals-dominoes.pdf 316.5 kB
  • PDF/animals-flashcard.pdf 700.4 kB
  • PDF/animals-from-the-book-baby-farm-animals.pdf 258.9 kB
  • PDF/animals-game-3.pdf 1.5 MB
  • PDF/animals-game.pdf 1.1 MB
  • PDF/animals-home-search.pdf 220.0 kB
  • PDF/animals-level-2.pdf 327.8 kB
  • PDF/animals-matching-2012.pdf 137.6 kB
  • PDF/animals-missing-1.pdf 536.9 kB
  • PDF/animals-pairwork.pdf 794.5 kB
  • PDF/animals-safari-be-ing.pdf 1.5 MB
  • PDF/animals-secret-message.pdf 782.6 kB
  • PDF/animals-wild-search.pdf 220.9 kB
  • PDF/animals.pdf 216.5 kB
  • PDF/ANIMALS_001.pdf 220.2 kB
  • PDF/animals_002.pdf 370.0 kB
  • PDF/animals_003.pdf 253.2 kB
  • PDF/animals_004.pdf 126.6 kB
  • PDF/animals_005.pdf 212.2 kB
  • PDF/animals_can.pdf 145.2 kB
  • PDF/animalseesaw.pdf 498.3 kB
  • PDF/another-brick-in-the-wall-p-mimio-1-mirta.pdf 86.2 kB
  • PDF/another-day-in-paradise-by-phill-collins.pdf 51.4 kB
  • PDF/another-day-in-paradise.pdf 34.6 kB
  • PDF/ans.pdf 41.8 kB
  • PDF/answer-the-questions.pdf 68.6 kB
  • PDF/answers-sport-at-heart.pdf 42.6 kB
  • PDF/ao-vocabulary.pdf 2.2 MB
  • PDF/apologize2.pdf 43.1 kB
  • PDF/apostrophe-worksheet.pdf 141.6 kB
  • PDF/apostrophes.pdf 453.0 kB
  • PDF/appearance-test.pdf 771.5 kB
  • PDF/appearance.pdf 264.2 kB
  • PDF/appearence.pdf 913.3 kB
  • PDF/appendix-2.pdf 344.0 kB
  • PDF/appliances-short-answers.pdf 234.1 kB
  • PDF/appliances_worksheet_full.pdf 136.6 kB
  • PDF/applying-for-a-job.pdf 355.4 kB
  • PDF/approve-or-disapprove-discussion.pdf 27.5 kB
  • PDF/April fools day wordsearch.pdf 215.7 kB
  • PDF/april-activities.pdf 81.2 kB
  • PDF/april-calendar.pdf 190.4 kB
  • PDF/april-showers-puzzle.pdf 121.3 kB
  • PDF/april_ws.pdf 70.0 kB
  • PDF/april_ws_001.pdf 70.0 kB
  • PDF/aquatic life.pdf 218.0 kB
  • PDF/arbor-day-activities.pdf 94.1 kB
  • PDF/are-you-gonna-go-my-way.pdf 46.9 kB
  • PDF/are_you_happy.pdf 64.5 kB
  • PDF/argument_language.pdf 708.2 kB
  • PDF/argument_language_001.pdf 708.2 kB
  • PDF/around-the-world-dishes.pdf 67.4 kB
  • PDF/art-in-writing-students-output.pdf 2.8 MB
  • PDF/art-worksheet.pdf 39.1 kB
  • PDF/art.pdf 1.2 MB
  • PDF/arthur-christmas.pdf 245.3 kB
  • PDF/articles-2.pdf 89.7 kB
  • PDF/articles-a-an-this-these.pdf 86.2 kB
  • PDF/articles-buses-and-trains.pdf 117.5 kB
  • PDF/articles-maze1.pdf 480.5 kB
  • PDF/articles-overview.pdf 59.5 kB
  • PDF/articles-tests.pdf 71.2 kB
  • PDF/articles.pdf 889.6 kB
  • PDF/articles_001.pdf 49.2 kB
  • PDF/articles_002.pdf 715.1 kB
  • PDF/articles_003.pdf 325.3 kB
  • PDF/ary_ery_ory.pdf 65.8 kB
  • PDF/as-it-ages.pdf 150.6 kB
  • PDF/as-long-as-you-love-me.pdf 63.9 kB
  • PDF/as-long-as-you-love-me_001.pdf 22.3 kB
  • PDF/as-review-topics.pdf 78.4 kB
  • PDF/ask_madam_wiseone_eflprofessionals.pdf 121.2 kB
  • PDF/asking-for-and-giving-directions.pdf 411.6 kB
  • PDF/asking-for-giving-directions.pdf 272.7 kB
  • PDF/asking-questions-in-the-past.pdf 362.9 kB
  • PDF/asking-questions.pdf 130.5 kB
  • PDF/assessment_adjective_noun.pdf 100.8 kB
  • PDF/asteroid.pdf 258.4 kB
  • PDF/at-a-shop.pdf 76.8 kB
  • PDF/at-school-2012.pdf 787.7 kB
  • PDF/at-school-multiple-choice.pdf 332.9 kB
  • PDF/at-the-beach.pdf 100.3 kB
  • PDF/at-the-castle.pdf 309.8 kB
  • PDF/at-the-supermarket.pdf 2.2 kB
  • PDF/attendance-record.pdf 80.4 kB
  • PDF/attrugly.pdf 214.1 kB
  • PDF/auction-bids.pdf 36.8 kB
  • PDF/august-activities.pdf 147.1 kB
  • PDF/august-awards.pdf 100.8 kB
  • PDF/august-bulletin-boards.pdf 290.3 kB
  • PDF/august-calendar-header.pdf 41.7 kB
  • PDF/august-calendar.pdf 61.5 kB
  • PDF/august-clipart.pdf 205.3 kB
  • PDF/august-dates.pdf 55.2 kB
  • PDF/august-images.pdf 2.4 MB
  • PDF/august-newsletter-2.pdf 94.1 kB
  • PDF/august-newsletter.pdf 169.1 kB
  • PDF/august-sunglasses-visor.pdf 61.3 kB
  • PDF/august-writing-template.pdf 70.6 kB
  • PDF/australia-angl.pdf 255.8 kB
  • PDF/australia.pdf 6.5 MB
  • PDF/autumn-activities.pdf 177.7 kB
  • PDF/autumn-bingo.pdf 239.5 kB
  • PDF/autumn-cross.pdf 1.3 MB
  • PDF/autumn-fabulous-fall-fun.pdf 780.5 kB
  • PDF/autumn-flashcards.pdf 912.7 kB
  • PDF/autumn-pictionary.pdf 334.2 kB
  • PDF/autumn-scene-writing.pdf 80.5 kB
  • PDF/autumn.pdf 385.8 kB
  • PDF/autumne-matching.pdf 53.3 kB
  • PDF/auxiliary-verbs.pdf 62.2 kB
  • PDF/awareness-campaigns-and-advertising.pdf 46.2 kB
  • PDF/awkward1.pdf 184.2 kB
  • PDF/awkward2.pdf 212.7 kB
  • PDF/b-day-vocabulary.pdf 476.3 kB
  • PDF/b1-relative-pronouns-who-which-where.pdf 78.5 kB
  • PDF/baby-animals.pdf 208.7 kB
  • PDF/back-to-december.pdf 288.1 kB
  • PDF/back-to-school-activities.pdf 41.9 kB
  • PDF/back-to-school-activity.pdf 6.2 kB
  • PDF/back-to-school.pdf 197.9 kB
  • PDF/back-to-school2uba.pdf 510.6 kB
  • PDF/back-to-the-future.pdf 1.2 MB
  • PDF/back2school-arts-crafts.pdf 765.9 kB
  • PDF/back2school-classroom-themes.pdf 78.5 kB
  • PDF/back2school-maze.pdf 91.4 kB
  • PDF/back2schooluba01.pdf 57.7 kB
  • PDF/bad-present.pdf 191.1 kB
  • PDF/balloons-guessing-game-gtky.pdf 12.0 kB
  • PDF/banking-terminology-crossword.pdf 94.6 kB
  • PDF/baralho.pdf 641.8 kB
  • PDF/base-and-strong-adjectives-game.pdf 14.1 kB
  • PDF/Basic Food Wordsearch.pdf 207.6 kB
  • PDF/basic-cards.pdf 49.3 kB
  • PDF/basic-computer-skills.pdf 1.0 MB
  • PDF/basic-english-questions-1.pdf 31.2 kB
  • PDF/basic-exam-verb-to-be-describe-prepositions.pdf 162.7 kB
  • PDF/basic-phrases-for-communication-in-english.pdf 143.8 kB
  • PDF/basic-questions.pdf 47.1 kB
  • PDF/basic-review.pdf 72.9 kB
  • PDF/basicpresentsimple.pdf 487.5 kB
  • PDF/basicpresentsimple_001.pdf 487.5 kB
  • PDF/basicpresentsimple_002.pdf 487.5 kB
  • PDF/basicpresentsimple_003.pdf 487.5 kB
  • PDF/bathroom.pdf 388.6 kB
  • PDF/bathroom_001.pdf 322.1 kB
  • PDF/bathroom_002.pdf 337.0 kB
  • PDF/bats.pdf 401.2 kB
  • PDF/battle-ship.pdf 27.1 kB
  • PDF/battle.pdf 17.2 kB
  • PDF/battleship-on-food.pdf 177.2 kB
  • PDF/batwords.pdf 187.0 kB
  • PDF/bc-wc-b.pdf 152.2 kB
  • PDF/be-get-used-to-would.pdf 293.1 kB
  • PDF/beat-it.pdf 70.1 kB
  • PDF/beauty-salon.pdf 132.1 kB
  • PDF/beautyplay.pdf 273.7 kB
  • PDF/because-you-loved-me-celine-dion-past-tense.pdf 373.2 kB
  • PDF/because-you-loved-me-printable.pdf 72.8 kB
  • PDF/bedroom.pdf 140.9 kB
  • PDF/been-or-gone-cards.pdf 2.9 kB
  • PDF/been-vs-gone.pdf 150.9 kB
  • PDF/beerbiking.pdf 35.0 kB
  • PDF/beg-3-present-continuous.pdf 67.6 kB
  • PDF/beginner-revision-test.pdf 257.2 kB
  • PDF/beginners20review2.pdf 68.5 kB
  • PDF/behaviorchart.pdf 191.7 kB
  • PDF/beijing-olympics-comparatives-and-superlatives.pdf 252.9 kB
  • PDF/being-happier.pdf 49.4 kB
  • PDF/being-human-e01s01-uk-vocabularyc1.pdf 192.3 kB
  • PDF/being-similar-two-of-a-kind.pdf 78.3 kB
  • PDF/bel6.pdf 38.5 kB
  • PDF/bell.pdf 290.6 kB
  • PDF/bellringer.pdf 73.0 kB
  • PDF/belongings-immigration-speakingreading-exam.pdf 284.6 kB
  • PDF/ben-hollys.pdf 148.1 kB
  • PDF/benjamin-zephaniah-serious-luv.pdf 404.6 kB
  • PDF/best-meaning.pdf 137.5 kB
  • PDF/best-thing-i-never-had-beyonce.pdf 296.2 kB
  • PDF/bethechange_extensive_reading_1.pdf 235.0 kB
  • PDF/betray.pdf 256.0 kB
  • PDF/beuty-drop-dead-diva.pdf 128.9 kB
  • PDF/beyonc-btinhad-vocab.pdf 355.3 kB
  • PDF/beyonce-irreplaceable.pdf 58.0 kB
  • PDF/beyonce.pdf 747.0 kB
  • PDF/big-pig.pdf 1.2 MB
  • PDF/big_board_answers-env.pdf 356.6 kB
  • PDF/billy-goats-gruff1.pdf 11.0 kB
  • PDF/billy-idol-dancing-with-myself.pdf 60.5 kB
  • PDF/billy-jean.pdf 36.9 kB
  • PDF/bing-on-habits-for-children.pdf 35.2 kB
  • PDF/bingo-cards-1x2.pdf 118.9 kB
  • PDF/bingo-november-rain.pdf 17.2 kB
  • PDF/bingo-tv-chairing-a-meeting.pdf 14.7 kB
  • PDF/bingo.pdf 53.5 kB
  • PDF/bingo2.pdf 112.9 kB
  • PDF/bingo_001.pdf 124.1 kB
  • PDF/bio-data.pdf 82.8 kB
  • PDF/biographical-deductions.pdf 335.5 kB
  • PDF/bird-mobile.pdf 113.2 kB
  • PDF/birds.pdf 459.2 kB
  • PDF/birthday.pdf 220.9 kB
  • PDF/biscuits-shapes.pdf 939.9 kB
  • PDF/bizarre-foods-unit.pdf 430.1 kB
  • PDF/blind.pdf 227.4 kB
  • PDF/bm01.pdf 317.0 kB
  • PDF/bm02.pdf 238.9 kB
  • PDF/bm03.pdf 172.7 kB
  • PDF/bm04.pdf 239.9 kB
  • PDF/bm05.pdf 215.5 kB
  • PDF/bm06.pdf 283.0 kB
  • PDF/bm07.pdf 200.8 kB
  • PDF/bm08.pdf 181.6 kB
  • PDF/board-game-on-manners.pdf 142.1 kB
  • PDF/board-game-situs-pre-int.pdf 952.5 kB
  • PDF/board-game-st-patrick.pdf 446.0 kB
  • PDF/board-game.pdf 921.1 kB
  • PDF/board-game_001.pdf 403.2 kB
  • PDF/board-game_irregular-verbs.pdf 45.3 kB
  • PDF/board.pdf 34.0 kB
  • PDF/board_game-introductions.pdf 191.8 kB
  • PDF/boardgame-correcting-mistakes.pdf 100.1 kB
  • PDF/boardgame-dailyroutines.pdf 121.8 kB
  • PDF/boardgame-parts-of-the-body.pdf 128.2 kB
  • PDF/boardthe.pdf 798.2 kB
  • PDF/bobbusyisl.pdf 320.0 kB
  • PDF/Body parts vocabulary Word Search.pdf 216.3 kB
  • PDF/BODY PARTS.pdf 220.0 kB
  • PDF/body-2.pdf 326.3 kB
  • PDF/body-cross-2012.pdf 388.7 kB
  • PDF/body-game.pdf 325.8 kB
  • PDF/body-multiple.pdf 506.3 kB
  • PDF/body-organs.pdf 454.7 kB
  • PDF/body-parts-1.pdf 418.2 kB
  • PDF/body-parts-2.pdf 426.5 kB
  • PDF/body-parts-3.pdf 402.8 kB
  • PDF/body-parts-4.pdf 372.1 kB
  • PDF/body-parts-homer.pdf 74.4 kB
  • PDF/body-parts-kids.pdf 274.1 kB
  • PDF/body.pdf 280.8 kB
  • PDF/body_001.pdf 369.3 kB
  • PDF/body_002.pdf 1.4 MB
  • PDF/bodyok.pdf 573.4 kB
  • PDF/bonfire-night-video-qus.pdf 289.8 kB
  • PDF/bonfire-night.pdf 66.0 kB
  • PDF/book-week-ivstd-to-up-load.pdf 93.3 kB
  • PDF/bookmarks.pdf 260.9 kB
  • PDF/books-and-reading.pdf 379.9 kB
  • PDF/books-or-movies.pdf 53.8 kB
  • PDF/born-to-die.pdf 38.3 kB
  • PDF/boundin.pdf 151.8 kB
  • PDF/box-2.pdf 42.2 kB
  • PDF/brain-tricks.pdf 1.8 MB
  • PDF/brambly-hedge_spring-story.pdf 41.1 kB
  • PDF/brave-movie-worksheet.pdf 1.5 MB
  • PDF/brazil-video-worksheet.pdf 394.0 kB
  • PDF/BREAKFAST FOOD WORDS.pdf 216.2 kB
  • PDF/breaking-benjamin-without-you-song-worksheets.pdf 178.6 kB
  • PDF/bribery-and-corruption.pdf 85.6 kB
  • PDF/bridgetjonesdiary.pdf 19.8 kB
  • PDF/bridgit-mendler-here-i-come-song-worksheet-part-1.pdf 395.1 kB
  • PDF/bridgit-mendler-here-i-come-song-worksheet-part-2.pdf 279.1 kB
  • PDF/britains-got-talent-worksheet.pdf 392.7 kB
  • PDF/british-english.pdf 438.4 kB
  • PDF/british-holidays.pdf 2.9 MB
  • PDF/british-money.pdf 164.3 kB
  • PDF/broccoli.pdf 277.8 kB
  • PDF/bruce-and-the-cat.pdf 38.8 kB
  • PDF/bt01.pdf 6.8 kB
  • PDF/bt02.pdf 6.0 kB
  • PDF/bt03.pdf 7.7 kB
  • PDF/bt04.pdf 5.6 kB
  • PDF/bt05.pdf 6.1 kB
  • PDF/bt06.pdf 11.1 kB
  • PDF/bts-sport-at-heart-london-olympics-copie.pdf 357.0 kB
  • PDF/Building Construction Housing Jobs Wordsearch.pdf 218.2 kB
  • PDF/building-and-places.pdf 332.5 kB
  • PDF/building-trades.pdf 503.1 kB
  • PDF/buildings-and-plavces-game.pdf 359.8 kB
  • PDF/bully.pdf 213.1 kB
  • PDF/bullying-listening-why-do-people-bully-and.pdf 65.1 kB
  • PDF/bullying-with-teachers-notes.pdf 1.4 MB
  • PDF/business-english-conditionals-board-game.pdf 235.9 kB
  • PDF/business-ethics-pres.pdf 60.2 kB
  • PDF/business-vocabulary.pdf 46.6 kB
  • PDF/businesses-are-in-crisis.pdf 198.3 kB
  • PDF/busy-teacher-present-continuous.pdf 245.3 kB
  • PDF/busy-teacher-to-be-adjectives.pdf 1.4 MB
  • PDF/busy-teacher.pdf 56.9 kB
  • PDF/busy-teacher_001.pdf 59.1 kB
  • PDF/busy.pdf 240.2 kB
  • PDF/busy_001.pdf 347.3 kB
  • PDF/busyteacherorg.pdf 256.1 kB
  • PDF/busyteacherorg_001.pdf 113.2 kB
  • PDF/butterfly.pdf 61.0 kB
  • PDF/button.pdf 167.0 kB
  • PDF/c.pdf 206.9 kB
  • PDF/c_001.pdf 65.0 kB
  • PDF/cae-prefix-warmer.pdf 21.9 kB
  • PDF/cal_sept_11.pdf 17.4 MB
  • PDF/caldron.pdf 1.0 MB
  • PDF/calendar.pdf 199.4 kB
  • PDF/california-king-bed-rihanna-parts-of-the-body.pdf 589.8 kB
  • PDF/california-king-bed.pdf 26.7 kB
  • PDF/californication.pdf 146.7 kB
  • PDF/calling-all-the-monsters-china-mclain.pdf 511.5 kB
  • PDF/calling-all-the-monsters.pdf 316.6 kB
  • PDF/calling-list.pdf 24.2 kB
  • PDF/camp-out.pdf 87.1 kB
  • PDF/camping-2012.pdf 237.1 kB
  • PDF/camping-wordsearch-2012.pdf 615.3 kB
  • PDF/camping.pdf 691.1 kB
  • PDF/Camping_001.pdf 220.0 kB
  • PDF/can-ability.pdf 444.4 kB
  • PDF/can-bonomo-love-me-back.pdf 183.6 kB
  • PDF/can-cant-couldnt-could-quiz.pdf 258.9 kB
  • PDF/can-cant-verbs.pdf 468.5 kB
  • PDF/can-cant.pdf 297.3 kB
  • PDF/can-i-go-to-the-bathroom.pdf 16.0 kB
  • PDF/can-i-go-to-the-toilet.pdf 98.7 kB
  • PDF/can-or-cant.pdf 101.4 kB
  • PDF/can-or-cant_001.pdf 30.6 kB
  • PDF/can-you-cards.pdf 704.8 kB
  • PDF/can-you-find-things-in-the-picture.pdf 180.7 kB
  • PDF/can-you-talk-about-things-you-like.pdf 326.8 kB
  • PDF/can-you.pdf 147.4 kB
  • PDF/can-zoo-animals-sing-worksheet.pdf 133.6 kB
  • PDF/can_may.pdf 47.2 kB
  • PDF/candy_box_val07.pdf 698.4 kB
  • PDF/captions-matching-game.pdf 1.6 MB
  • PDF/Car Parts.pdf 215.9 kB
  • PDF/car-accidents-worksheet.pdf 42.6 kB
  • PDF/car-parts.pdf 113.5 kB
  • PDF/car-repair.pdf 53.5 kB
  • PDF/car.pdf 230.6 kB
  • PDF/card-games-questions.pdf 65.8 kB
  • PDF/card_games_on_irregular_verbs.pdf 335.5 kB
  • PDF/card_games_on_irregular_verbs_001.pdf 335.5 kB
  • PDF/cardinal-game.pdf 533.2 kB
  • PDF/cardinal-numbers-cards.pdf 276.2 kB
  • PDF/cardinal-numbers.pdf 92.0 kB
  • PDF/cards_game.pdf 318.0 kB
  • PDF/carlos-fuentes-biography.pdf 654.6 kB
  • PDF/carly-rae-jepsen-call-me-maybe-past-simple-and.pdf 39.0 kB
  • PDF/carly-rae-jepsen-call-me-maybe-song-activity.pdf 48.8 kB
  • PDF/CARNIVAL IN RIO.pdf 220.0 kB
  • PDF/carnival.pdf 178.2 kB
  • PDF/cars-or-people.pdf 35.5 kB
  • PDF/cartography.pdf 212.4 kB
  • PDF/cartoon.pdf 199.6 kB
  • PDF/cat_word_maze.pdf 285.4 kB
  • PDF/catch-me-if-you-can.pdf 757.7 kB
  • PDF/categories-and-classification.pdf 52.5 kB
  • PDF/category-game.pdf 2.4 MB
  • PDF/caterpillar-puzzle.pdf 214.5 kB
  • PDF/Cats.pdf 214.6 kB
  • PDF/causativeconstructions.pdf 59.5 kB
  • PDF/cc_wk-5_simple-present-school-verbs.pdf 200.4 kB
  • PDF/celeste-buckingham-run-run-run.pdf 109.9 kB
  • PDF/cellphones.pdf 127.8 kB
  • PDF/ch-18-complements.pdf 513.3 kB
  • PDF/challenges.pdf 30.7 kB
  • PDF/change.pdf 1.2 MB
  • PDF/changes-in-passive-sentences-with-reporting-verbs.pdf 9.6 kB
  • PDF/changes.pdf 1.0 MB
  • PDF/chapter-1-5-reading-comprehension-questions.pdf 33.5 kB
  • PDF/chapter-11-audio-bath-student.pdf 100.1 kB
  • PDF/Character adjectives .pdf 220.1 kB
  • PDF/Character Adjectives.pdf 218.1 kB
  • PDF/character-flash.pdf 794.3 kB
  • PDF/character-flashcards.pdf 309.1 kB
  • PDF/character.pdf 217.7 kB
  • PDF/character_001.pdf 246.7 kB
  • PDF/character_002.pdf 3.4 MB
  • PDF/characterreportcardpdf.pdf 65.4 kB
  • PDF/charades-cards.pdf 517.4 kB
  • PDF/charlie-and-the-chocolate-factory.pdf 377.8 kB
  • PDF/charlie-and-the-chocolate-factory_001.pdf 135.3 kB
  • PDF/chart-future.pdf 339.9 kB
  • PDF/chart.pdf 84.2 kB
  • PDF/chasing-cars.pdf 156.6 kB
  • PDF/check-and-control-with-expressions.pdf 583.4 kB
  • PDF/checking-your-grammar.pdf 532.0 kB
  • PDF/cheers-final.pdf 302.9 kB
  • PDF/chef.pdf 210.7 kB
  • PDF/chemicals.pdf 49.4 kB
  • PDF/chemicalscrossword.pdf 46.3 kB
  • PDF/chemists-pictionary.pdf 544.4 kB
  • PDF/Chess.pdf 207.4 kB
  • PDF/chicken-licken-ppt-sample.pdf 1.4 MB
  • PDF/children-for-whom-school-means-nothing.pdf 244.7 kB
  • PDF/childrens_songs.pdf 372.7 kB
  • PDF/chimpanzee-video.pdf 48.6 kB
  • PDF/chocolate-cake-recipe.pdf 118.7 kB
  • PDF/choose-the-correct-word-and-colour.pdf 209.3 kB
  • PDF/choose-weather.pdf 198.1 kB
  • PDF/chores-speaking-activity.pdf 128.4 kB
  • PDF/chores.pdf 118.0 kB
  • PDF/Christmas Mistletoe.pdf 215.2 kB
  • PDF/Christmas Word Search.pdf 220.1 kB
  • PDF/christmas-arts-and-crafts.pdf 2.9 MB
  • PDF/christmas-board-2011.pdf 451.7 kB
  • PDF/christmas-cards2.pdf 2.4 MB
  • PDF/christmas-carol-booklet.pdf 72.7 kB
  • PDF/christmas-crossword.pdf 817.6 kB
  • PDF/christmas-game-2.pdf 796.1 kB
  • PDF/christmas-game.pdf 1.6 MB
  • PDF/christmas-gingerbread-cookies-recipe.pdf 774.0 kB
  • PDF/christmas-handbag.pdf 671.2 kB
  • PDF/christmas-holiday-trivia.pdf 200.7 kB
  • PDF/christmas-in-australia.pdf 251.1 kB
  • PDF/christmas-in-canada.pdf 266.1 kB
  • PDF/christmas-in-india.pdf 182.1 kB
  • PDF/christmas-in-ireland.pdf 180.8 kB
  • PDF/christmas-in-the-united-kingdom.pdf 220.8 kB
  • PDF/christmas-is-coming-test-konkursowy.pdf 102.6 kB
  • PDF/christmas-matching.pdf 104.7 kB
  • PDF/christmas-minibook.pdf 206.6 kB
  • PDF/christmas-poster.pdf 657.6 kB
  • PDF/christmas-printables_gift_tags.pdf 542.6 kB
  • PDF/christmas-printables_santa_stationery.pdf 895.5 kB
  • PDF/christmas-project-easy-reindeer.pdf 341.0 kB
  • PDF/christmas-puff_envelope_giftbox.pdf 903.7 kB
  • PDF/christmas-pyramid_giftbox.pdf 467.1 kB
  • PDF/christmas-quiz.pdf 45.1 kB
  • PDF/christmas-quiz_001.pdf 686.3 kB
  • PDF/christmas-quiz_002.pdf 191.9 kB
  • PDF/christmas-reading.pdf 140.3 kB
  • PDF/christmas-snowflakes.pdf 71.0 kB
  • PDF/christmas-snowman.pdf 209.5 kB
  • PDF/christmas-tree-puppet.pdf 161.5 kB
  • PDF/christmas-trimatree.pdf 125.2 kB
  • PDF/christmas-van_giftbox.pdf 493.5 kB
  • PDF/christmas-voc.pdf 460.1 kB
  • PDF/christmas-vocabulary-elementary.pdf 918.0 kB
  • PDF/christmas-vocabulary.pdf 172.6 kB
  • PDF/christmas-vocabulary_001.pdf 814.7 kB
  • PDF/christmas-wishlist.pdf 161.4 kB
  • PDF/christmas-word-find.pdf 318.9 kB
  • PDF/christmas.pdf 150.9 kB
  • PDF/christmas_001.pdf 227.3 kB
  • PDF/christmas_002.pdf 473.3 kB
  • PDF/christmas_color_game1.pdf 91.5 kB
  • PDF/christmas_garland-2.pdf 349.4 kB
  • PDF/christmas_garland.pdf 324.9 kB
  • PDF/Christmas_material_package_2010.pdf 12.8 MB
  • PDF/christmas_poem_scholastic.pdf 125.2 kB
  • PDF/christmaspt2.pdf 85.0 kB
  • PDF/cindarella.pdf 49.2 kB
  • PDF/cinderella-3-kopiyi.pdf 60.4 kB
  • PDF/cinderella_maze.pdf 43.6 kB
  • PDF/Cinema and Films.pdf 220.4 kB
  • PDF/cinema-and-films.pdf 416.6 kB
  • PDF/cinema.pdf 352.9 kB
  • PDF/cinko.pdf 85.2 kB
  • PDF/cinko2.pdf 141.6 kB
  • PDF/cinquain.pdf 91.6 kB
  • PDF/City life word search.pdf 212.4 kB
  • PDF/city-of-blinding-lights.pdf 49.5 kB
  • PDF/city.pdf 212.5 kB
  • PDF/Civil Rights Word Search.pdf 220.2 kB
  • PDF/civil-war-play.pdf 58.9 kB
  • PDF/clase-2-like-olympic-games.pdf 283.8 kB
  • PDF/clase-art-spirituality.pdf 536.3 kB
  • PDF/class-calendar.pdf 1.3 MB
  • PDF/class-instructions.pdf 146.4 kB
  • PDF/class-rules.pdf 686.7 kB
  • PDF/classify-the-following-items-according-to-the.pdf 177.3 kB
  • PDF/classrom-objects-worksheet2.pdf 184.1 kB
  • PDF/classroom-game.pdf 332.9 kB
  • PDF/classroom-language-for-physical-education.pdf 850.2 kB
  • PDF/classroom-language-for-students.pdf 118.5 kB
  • PDF/classroom-language-matchng.pdf 177.5 kB
  • PDF/classroom-language-matchng_001.pdf 177.6 kB
  • PDF/classroom-language.pdf 684.0 kB
  • PDF/classroom-language_001.pdf 479.3 kB
  • PDF/classroom-language_002.pdf 58.6 kB
  • PDF/classroom-language_003.pdf 181.7 kB
  • PDF/classroom-newspaper.pdf 31.0 kB
  • PDF/classroom-objects-pdf.pdf 188.7 kB
  • PDF/classroom-objects.pdf 73.5 kB
  • PDF/classroom-quiz.pdf 61.0 kB
  • PDF/classroom-supplies-mc.pdf 482.8 kB
  • PDF/clauses-of-contrast.pdf 66.7 kB
  • PDF/clauses.pdf 146.8 kB
  • PDF/cleaning-supplies.pdf 2.3 MB
  • PDF/click.pdf 175.6 kB
  • PDF/climate-and-seasons.pdf 216.8 kB
  • PDF/climate-change.pdf 69.1 kB
  • PDF/clipart-for-song.pdf 312.3 kB
  • PDF/clock.pdf 141.1 kB
  • PDF/clockbuddies.pdf 153.6 kB
  • PDF/closed-questions-and-short-answers-practice.pdf 155.1 kB
  • PDF/closer-to-the-edge-30secs-2-mars-acoustic.pdf 584.4 kB
  • PDF/clothe-wordsearch.pdf 595.1 kB
  • PDF/Clothes Fashion.pdf 212.3 kB
  • PDF/Clothes Elementary Word Search.pdf 216.4 kB
  • PDF/clothes-crossword.pdf 216.5 kB
  • PDF/clothes-dictionary.pdf 564.9 kB
  • PDF/clothes-missing-vowels.pdf 640.3 kB
  • PDF/clothes-missing.pdf 386.6 kB
  • PDF/clothes-pairwork.pdf 442.6 kB
  • PDF/clothes-pictionary-1-poster-vocabulary-worksheet.pdf 1.5 MB
  • PDF/clothes-riddles.pdf 329.7 kB
  • PDF/clothes-target-board.pdf 89.7 kB
  • PDF/clothes.pdf 118.2 kB
  • PDF/clothes3.pdf 268.8 kB
  • PDF/Clothes_001.pdf 212.3 kB
  • PDF/clothes_002.pdf 492.5 kB
  • PDF/clothes_003.pdf 95.4 kB
  • PDF/clothes_004.pdf 975.0 kB
  • PDF/clothes_005.pdf 1.3 MB
  • PDF/clothes_006.pdf 319.1 kB
  • PDF/clothes_007.pdf 36.8 kB
  • PDF/clothes_008.pdf 442.0 kB
  • PDF/clothes_009.pdf 1.1 MB
  • PDF/clothes_cards.pdf 394.7 kB
  • PDF/clouds-across-the-moon.pdf 246.3 kB
  • PDF/cloze-test-all-about-reading.pdf 110.6 kB
  • PDF/coach-carter-trailer-qus.pdf 475.8 kB
  • PDF/Coffee Wordsearch.pdf 215.8 kB
  • PDF/coldplay-viva-la-vida-lyrics.pdf 30.5 kB
  • PDF/collocations.pdf 21.3 kB
  • PDF/collocations_001.pdf 156.1 kB
  • PDF/colloquial-and-informal-expressions.pdf 290.1 kB
  • PDF/color-idioms.pdf 1.4 MB
  • PDF/color-shape_1difficult.pdf 85.2 kB
  • PDF/color-shape_2difficult.pdf 85.5 kB
  • PDF/color-shape_easy.pdf 85.1 kB
  • PDF/color.pdf 948.1 kB
  • PDF/color_001.pdf 43.2 kB
  • PDF/color_002.pdf 51.0 kB
  • PDF/coloringbook.pdf 521.4 kB
  • PDF/colors-wordsearch.pdf 66.1 kB
  • PDF/colors.pdf 124.2 kB
  • PDF/colors_001.pdf 217.6 kB
  • PDF/colorwordsearch.pdf 37.0 kB
  • PDF/colour-by-number.pdf 239.6 kB
  • PDF/colour-by-number_001.pdf 313.8 kB
  • PDF/colour-chart.pdf 259.2 kB
  • PDF/colour-idioms.pdf 128.3 kB
  • PDF/colour-in-the-country.pdf 321.5 kB
  • PDF/colour-these-balloons.pdf 40.0 kB
  • PDF/colour-word-search.pdf 312.8 kB
  • PDF/Colours Animals Food Numbers Word Search.pdf 221.3 kB
  • PDF/colours-adj.pdf 1.6 MB
  • PDF/colours-and-prepositions.pdf 18.7 kB
  • PDF/colours-book-marks.pdf 484.8 kB
  • PDF/colours-dominoes.pdf 28.6 kB
  • PDF/colours-game-2012.pdf 1.3 MB
  • PDF/colours-match.pdf 175.4 kB
  • PDF/colours-matching.pdf 82.9 kB
  • PDF/colours-wheel.pdf 237.0 kB
  • PDF/colours-with-sound.pdf 282.3 kB
  • PDF/colours.pdf 106.4 kB
  • PDF/Colours_001.pdf 215.9 kB
  • PDF/colours_002.pdf 676.4 kB
  • PDF/colours_003.pdf 383.4 kB
  • PDF/colours_004.pdf 47.2 kB
  • PDF/colours_005.pdf 68.7 kB
  • PDF/comic-dialogue.pdf 85.4 kB
  • PDF/comida-adivinar-plato.pdf 177.1 kB
  • PDF/commands-students.pdf 141.1 kB
  • PDF/common-verbs.pdf 93.8 kB
  • PDF/common-words.pdf 605.9 kB
  • PDF/Communication Word Search.pdf 219.9 kB
  • PDF/comp-sup.pdf 2.1 MB
  • PDF/comp-superl-stars4.pdf 31.4 kB
  • PDF/comparative-adjactives-presentation.pdf 1.3 MB
  • PDF/comparative-adjective.pdf 344.8 kB
  • PDF/comparative-adjectives.pdf 66.0 kB
  • PDF/comparative-adjectives_001.pdf 214.8 kB
  • PDF/comparative-and-superlative-adjectives-revision.pdf 77.3 kB
  • PDF/comparative-superlative.pdf 93.4 kB
  • PDF/comparative.pdf 220.5 kB
  • PDF/comparative_001.pdf 1.1 MB
  • PDF/comparative_superlative-degree.pdf 359.1 kB
  • PDF/Comparatives (Bigger & Better) (2).pdf 34.6 kB
  • PDF/Comparatives (Bigger & Better).pdf 34.6 kB
  • PDF/Comparatives (Bigger & Better)_001.pdf 34.6 kB
  • PDF/comparatives-1.pdf 153.5 kB
  • PDF/comparatives-2.pdf 113.1 kB
  • PDF/comparatives-and-superlatives.pdf 209.6 kB
  • PDF/Comparatives.pdf 219.7 kB
  • PDF/comparatives_001.pdf 458.6 kB
  • PDF/comparatives_002.pdf 197.8 kB
  • PDF/comparatives_003.pdf 97.5 kB
  • PDF/compare-mouse-elephant.pdf 151.3 kB
  • PDF/comparing-america-with-russia.pdf 174.9 kB
  • PDF/comparison-of-adjectives-practice.pdf 367.1 kB
  • PDF/comparison-of-adjectives.pdf 79.3 kB
  • PDF/comparison-short-adjectives.pdf 48.6 kB
  • PDF/comparison-the-rule.pdf 1.6 MB
  • PDF/comparison.pdf 37.0 kB
  • PDF/comparison21.pdf 1.2 MB
  • PDF/complaint-after-sales.pdf 56.4 kB
  • PDF/complaint.pdf 54.9 kB
  • PDF/complaints.pdf 22.2 kB
  • PDF/complete-the-cv-using-the-info.pdf 61.3 kB
  • PDF/complete-the-following-chart-1.pdf 45.7 kB
  • PDF/complete-the-gaps-with-one-word.pdf 182.4 kB
  • PDF/complicatedactividad.pdf 136.9 kB
  • PDF/composite-questions.pdf 71.0 kB
  • PDF/COMPOUND WORDS.pdf 211.1 kB
  • PDF/compound-nouns.pdf 94.5 kB
  • PDF/compound-words-closed-forms.pdf 535.4 kB
  • PDF/comprehension_question-types.pdf 38.5 kB
  • PDF/Computer Parts.pdf 217.8 kB
  • PDF/computer-keyboard-symbols.pdf 377.1 kB
  • PDF/computer.pdf 318.7 kB
  • PDF/computer_001.pdf 469.5 kB
  • PDF/concentr.pdf 43.4 kB
  • PDF/concentration-rules.pdf 115.9 kB
  • PDF/concept-check-symptoms.pdf 336.7 kB
  • PDF/cond.pdf 122.2 kB
  • PDF/cond_001.pdf 58.0 kB
  • PDF/condional-sentences.pdf 751.9 kB
  • PDF/conditional-3_presto.pdf 103.2 kB
  • PDF/conditional-clauses-introduces-by-when-unless.pdf 416.5 kB
  • PDF/conditional-sentences-game.pdf 181.2 kB
  • PDF/conditional-sentences.pdf 295.4 kB
  • PDF/conditional-sentences_-ana_dec.pdf 162.1 kB
  • PDF/conditional-sentences_001.pdf 50.3 kB
  • PDF/conditional-type-1.pdf 229.6 kB
  • PDF/conditional.pdf 98.0 kB
  • PDF/conditionalclauses-1.pdf 124.2 kB
  • PDF/conditionals-0123.pdf 520.7 kB
  • PDF/conditionals-2.pdf 59.7 kB
  • PDF/conditionals-contrast.pdf 136.1 kB
  • PDF/conditionals-review.pdf 294.9 kB
  • PDF/conditionals-summary.pdf 150.7 kB
  • PDF/conditionals-written-exercise.pdf 19.3 kB
  • PDF/conditionals.pdf 381.4 kB
  • PDF/conditionals_001.pdf 418.8 kB
  • PDF/conjuctions-but-because-and-esl-1.pdf 209.1 kB
  • PDF/conjunctions-overview.pdf 40.3 kB
  • PDF/connectors-and-linkers.pdf 1.7 MB
  • PDF/connectors.pdf 42.6 kB
  • PDF/consonant-sounds-phonics-assessment.pdf 182.9 kB
  • PDF/containers.pdf 479.2 kB
  • PDF/continuous-past-tense-fact-sheet.pdf 102.8 kB
  • PDF/conversation-a-mirror-before-your-very-eyes.pdf 123.4 kB
  • PDF/conversation-cards-going-on-holiday6236.pdf 103.6 kB
  • PDF/conversation-on-sports.pdf 363.1 kB
  • PDF/conversation-questions.pdf 218.7 kB
  • PDF/conversation_corner.pdf 314.0 kB
  • PDF/conversclasstoys.pdf 40.9 kB
  • PDF/cookie-monster-in-the-library-beg.pdf 48.3 kB
  • PDF/cooking-verbs.pdf 797.4 kB
  • PDF/cooking-vocabulary.pdf 980.7 kB
  • PDF/cooking.pdf 211.8 kB
  • PDF/copia-de-happy-new-year.pdf 91.5 kB
  • PDF/copie-de-types-of-homes.pdf 57.5 kB
  • PDF/coraline-worksheet.pdf 794.7 kB
  • PDF/correct-mistakes.pdf 24.7 kB
  • PDF/corrige769-why-take-a-gap-year-bts.pdf 103.2 kB
  • PDF/Cosmetics.pdf 218.0 kB
  • PDF/couldnt-practice.pdf 132.7 kB
  • PDF/count-and-match.pdf 268.5 kB
  • PDF/count-on-me-by-bruno-mars.pdf 48.0 kB
  • PDF/countable-and-uncountable-nouns.pdf 60.5 kB
  • PDF/countable-and-uncountable-nouns02.pdf 309.8 kB
  • PDF/countable-and-uncountable.pdf 311.9 kB
  • PDF/countable-nouns.pdf 27.6 kB
  • PDF/countable-uncountable-nouns.pdf 1.2 MB
  • PDF/countables-x-uncountables.pdf 244.7 kB
  • PDF/countableuncountablenouns20qs.pdf 6.5 kB
  • PDF/COUNTRIES AND NATIONALITIES ELEMENTARY.pdf 212.2 kB
  • PDF/COUNTRIES AND NATIONALITIES.pdf 212.4 kB
  • PDF/Countries Beginner Word Search.pdf 219.9 kB
  • PDF/Countries capitals languages.pdf 212.5 kB
  • PDF/countries-and-nationalities.pdf 214.2 kB
  • PDF/countries-flashcards.pdf 582.1 kB
  • PDF/countries-nationalities-colors-flags-elementary.pdf 659.0 kB
  • PDF/countries-nationalities-languages-activity.pdf 303.4 kB
  • PDF/Countries.pdf 218.2 kB
  • PDF/countries_001.pdf 512.4 kB
  • PDF/countriesbingo.pdf 130.0 kB
  • PDF/countriesnationalitiesflags.pdf 62.4 kB
  • PDF/countriessplit.pdf 97.5 kB
  • PDF/country.pdf 239.9 kB
  • PDF/country_001.pdf 235.1 kB
  • PDF/couple-game-places-in-the-city.pdf 867.5 kB
  • PDF/couplets.pdf 103.8 kB
  • PDF/cpe-set-expressions.pdf 21.1 kB
  • PDF/cr-dhfc-pi.pdf 108.0 kB
  • PDF/cradleandall.pdf 202.2 kB
  • PDF/crayola-coloring-book.pdf 1.6 MB
  • PDF/crayola-coloring-pages-a-valentines-day-gift.pdf 100.4 kB
  • PDF/crazy-over-vegetables-exercise.pdf 44.4 kB
  • PDF/create-a-new-you.pdf 30.9 kB
  • PDF/cri.pdf 18.2 kB
  • PDF/crickets.pdf 980.0 kB
  • PDF/Crime Criminals Word Search.pdf 220.4 kB
  • PDF/Crime and Punishment - wordsearch.pdf 216.5 kB
  • PDF/Crime and Punishment Tile Puzzle.pdf 215.8 kB
  • PDF/Crime and Punishment Word Puzzle.pdf 212.5 kB
  • PDF/Crime and Punishment.pdf 212.0 kB
  • PDF/CRIME AND PUNISHMENT_001.pdf 220.4 kB
  • PDF/crime-and-punishment.pdf 382.9 kB
  • PDF/crime-idioms.pdf 51.1 kB
  • PDF/crime-story-writing-prompts-unit-4.pdf 60.9 kB
  • PDF/crime-word-search.pdf 220.0 kB
  • PDF/crime.pdf 216.5 kB
  • PDF/crime_001.pdf 61.7 kB
  • PDF/crime_or_offense_definition_answer-2.pdf 93.8 kB
  • PDF/critical-thinking-2sem.pdf 400.2 kB
  • PDF/croc.pdf 278.9 kB
  • PDF/crossword-the-farm.pdf 120.8 kB
  • PDF/crossword.pdf 55.4 kB
  • PDF/crossword_transport.pdf 136.1 kB
  • PDF/crossword_transport_001.pdf 136.1 kB
  • PDF/crosswords-3.pdf 24.9 kB
  • PDF/cry-cry-by-oceana-song-worksheet.pdf 269.0 kB
  • PDF/cultura-inglesa-video-lesson.pdf 158.5 kB
  • PDF/cumulative-tense-test-a.pdf 166.7 kB
  • PDF/curious-george.pdf 166.0 kB
  • PDF/current-events-eoc.pdf 55.0 kB
  • PDF/customer-complaint-role-play.pdf 28.5 kB
  • PDF/cut-edge-int-res.pdf 325.8 kB
  • PDF/cutt_edge_elem_module_1.pdf 19.8 kB
  • PDF/cutt_edge_elem_module_10.pdf 69.0 kB
  • PDF/cutt_edge_elem_module_10_001.pdf 69.0 kB
  • PDF/cutt_edge_elem_module_11.pdf 18.7 kB
  • PDF/cutt_edge_elem_module_11_001.pdf 18.7 kB
  • PDF/cutt_edge_elem_module_12.pdf 16.6 kB
  • PDF/cutt_edge_elem_module_12_001.pdf 16.6 kB
  • PDF/cutt_edge_elem_module_13.pdf 18.5 kB
  • PDF/cutt_edge_elem_module_13_001.pdf 18.5 kB
  • PDF/cutt_edge_elem_module_14.pdf 13.8 kB
  • PDF/cutt_edge_elem_module_14_001.pdf 13.8 kB
  • PDF/cutt_edge_elem_module_15.pdf 13.2 kB
  • PDF/cutt_edge_elem_module_15_001.pdf 13.2 kB
  • PDF/cutt_edge_elem_module_1_001.pdf 19.8 kB
  • PDF/cutt_edge_elem_module_2.pdf 18.9 kB
  • PDF/cutt_edge_elem_module_2_001.pdf 18.9 kB
  • PDF/cutt_edge_elem_module_3.pdf 19.4 kB
  • PDF/cutt_edge_elem_module_3_001.pdf 19.4 kB
  • PDF/cutt_edge_elem_module_4.pdf 33.3 kB
  • PDF/cutt_edge_elem_module_4_001.pdf 33.3 kB
  • PDF/cutt_edge_elem_module_5.pdf 19.8 kB
  • PDF/cutt_edge_elem_module_5_001.pdf 19.8 kB
  • PDF/cutt_edge_elem_module_6.pdf 82.1 kB
  • PDF/cutt_edge_elem_module_6_001.pdf 82.1 kB
  • PDF/cutt_edge_elem_module_7.pdf 73.7 kB
  • PDF/cutt_edge_elem_module_7_001.pdf 73.7 kB
  • PDF/cutt_edge_elem_module_8.pdf 92.6 kB
  • PDF/cutt_edge_elem_module_8_001.pdf 92.6 kB
  • PDF/cutt_edge_elem_module_9.pdf 79.3 kB
  • PDF/cutt_edge_elem_module_9_001.pdf 79.3 kB
  • PDF/cutt_edge_preint.pdf 22.8 kB
  • PDF/cutt_edge_preint_001.pdf 22.8 kB
  • PDF/cutt_edge_preint_module_1.pdf 36.4 kB
  • PDF/cutt_edge_preint_module_1_001.pdf 36.4 kB
  • PDF/cutt_edge_preint_module_2.pdf 20.9 kB
  • PDF/cutt_edge_preint_module_2_001.pdf 20.9 kB
  • PDF/cutt_edge_preint_module_4.pdf 19.2 kB
  • PDF/cutt_edge_preint_module_4_001.pdf 19.2 kB
  • PDF/cutt_edge_start_module_1.pdf 102.4 kB
  • PDF/cutt_edge_start_module_11.pdf 83.5 kB
  • PDF/cutt_edge_start_module_11_001.pdf 83.5 kB
  • PDF/cutt_edge_start_module_12.pdf 87.4 kB
  • PDF/cutt_edge_start_module_12_001.pdf 87.4 kB
  • PDF/cutt_edge_start_module_1_001.pdf 102.4 kB
  • PDF/cutt_edge_start_module_2.pdf 97.2 kB
  • PDF/cutt_edge_start_module_2_001.pdf 97.2 kB
  • PDF/cutt_edge_start_module_3.pdf 87.6 kB
  • PDF/cutt_edge_start_module_3_001.pdf 87.6 kB
  • PDF/cutt_edge_start_module_4.pdf 93.9 kB
  • PDF/cutt_edge_start_module_4_001.pdf 93.9 kB
  • PDF/cutt_edge_start_module_5.pdf 83.7 kB
  • PDF/cutt_edge_start_module_5_001.pdf 83.7 kB
  • PDF/cutt_edge_start_module_6.pdf 83.6 kB
  • PDF/cutt_edge_start_module_6_001.pdf 83.6 kB
  • PDF/cutt_edge_start_module_7.pdf 84.3 kB
  • PDF/cutt_edge_start_module_7_001.pdf 84.3 kB
  • PDF/cutt_edge_start_module_8.pdf 85.4 kB
  • PDF/cutt_edge_start_module_8_001.pdf 85.4 kB
  • PDF/cutt_edge_start_module_9.pdf 75.2 kB
  • PDF/cutt_edge_start_module_9_001.pdf 75.2 kB
  • PDF/cuttedge-upint.pdf 144.3 kB
  • PDF/cv_profile.pdf 51.0 kB
  • PDF/daily-activities-board-game.pdf 344.1 kB
  • PDF/daily-cards.pdf 269.0 kB
  • PDF/daily-phrases-1.pdf 219.7 kB
  • PDF/daily-routine-chart.pdf 550.4 kB
  • PDF/daily-routine-esl.pdf 228.9 kB
  • PDF/daily-routines-dice.pdf 174.0 kB
  • PDF/daily-routines-wh-questions-personal-pronouns.pdf 103.6 kB
  • PDF/daily-routines-wordsearch.pdf 249.8 kB
  • PDF/daily-routines.pdf 367.9 kB
  • PDF/daily-routines1.pdf 209.7 kB
  • PDF/daily-routines_001.pdf 359.7 kB
  • PDF/damien-jurado-abilene-worksheet.pdf 31.0 kB
  • PDF/damien-rice-cold-cold-water.pdf 15.1 kB
  • PDF/dance.pdf 203.4 kB
  • PDF/dates.pdf 537.3 kB
  • PDF/dating.pdf 202.1 kB
  • PDF/david-byrne-song-simple-past.pdf 46.1 kB
  • PDF/daycare.pdf 269.4 kB
  • PDF/Days Months Seasons.pdf 218.3 kB
  • PDF/Days of the week.pdf 214.2 kB
  • PDF/Days of week.pdf 217.6 kB
  • PDF/days-flash.pdf 1.5 MB
  • PDF/days-month-dates.pdf 118.7 kB
  • PDF/days-of-the-week-poster.pdf 1.3 MB
  • PDF/days-of-the-week-poster_001.pdf 110.0 kB
  • PDF/days-of-the-week-poster_002.pdf 197.4 kB
  • PDF/days-of-thw-week-train.pdf 355.5 kB
  • PDF/daysoftheweek.pdf 46.9 kB
  • PDF/deaf.pdf 234.1 kB
  • PDF/dearschoolnurse.pdf 200.1 kB
  • PDF/death-penalty-worksheet.pdf 496.7 kB
  • PDF/debate-topics.pdf 48.3 kB
  • PDF/debates-useful-lg.pdf 57.6 kB
  • PDF/dec-2010.pdf 859.9 kB
  • PDF/december-calendar-2.pdf 175.7 kB
  • PDF/december-calendar.pdf 906.3 kB
  • PDF/december-newsletter.pdf 76.0 kB
  • PDF/december-weather.pdf 328.4 kB
  • PDF/decoding-easter.pdf 231.9 kB
  • PDF/definite-and-indefinite-articles.pdf 350.1 kB
  • PDF/definitions.pdf 61.8 kB
  • PDF/degrees-of-comparison.pdf 845.6 kB
  • PDF/demonstrative-adjectives.pdf 428.5 kB
  • PDF/demonstrative-pronouns.pdf 301.9 kB
  • PDF/demonstratives.pdf 177.6 kB
  • PDF/derivation-new-msbee.pdf 211.6 kB
  • PDF/describe-a-lifestyle.pdf 136.4 kB
  • PDF/describe-the-simpsons.pdf 74.2 kB
  • PDF/describe-these-people.pdf 147.0 kB
  • PDF/describe-your-person.pdf 75.8 kB
  • PDF/Describing feelings.pdf 213.8 kB
  • PDF/Describing People Wordsearch.pdf 218.0 kB
  • PDF/describing people.pdf 220.3 kB
  • PDF/describing-actions-at-a-specific-time-in-the-past.pdf 222.9 kB
  • PDF/describing-big-ben.pdf 128.8 kB
  • PDF/describing-character.pdf 847.3 kB
  • PDF/describing-famous-people.pdf 486.8 kB
  • PDF/describing-feelings-and-personality.pdf 65.0 kB
  • PDF/describing-houses.pdf 1.6 MB
  • PDF/describing-people-cards.pdf 540.3 kB
  • PDF/describing-people-confusable-structures.pdf 6.9 kB
  • PDF/describing-people.pdf 180.5 kB
  • PDF/describing-people_adjectives_vocabulary-worksheet.pdf 164.2 kB
  • PDF/describing-someone.pdf 82.8 kB
  • PDF/describing-your-house.pdf 114.9 kB
  • PDF/descring_an_object.pdf 581.2 kB
  • PDF/descring_an_object_001.pdf 581.2 kB
  • PDF/description-placespeopleclothes.pdf 53.5 kB
  • PDF/descriptions.pdf 1.5 MB
  • PDF/descriptions_001.pdf 216.9 kB
  • PDF/descriptive-words-worksheet.pdf 235.4 kB
  • PDF/descriptive-writing.pdf 31.5 kB
  • PDF/desert-island.pdf 392.1 kB
  • PDF/desp-house-s1-ep1-6.pdf 1.3 MB
  • PDF/destinys-child-survivor-gap.pdf 53.8 kB
  • PDF/dexter.pdf 190.5 kB
  • PDF/dhobbies-crossword-2012.pdf 717.5 kB
  • PDF/dialogues.pdf 576.5 kB
  • PDF/diary-of-a-bored-girl-pres-simple-pres-continuous.pdf 324.1 kB
  • PDF/dice-christmas.pdf 601.5 kB
  • PDF/dice-colours.pdf 688.4 kB
  • PDF/dictionary-drill-activity-plan.pdf 555.6 kB
  • PDF/dictionary-lesson.pdf 352.9 kB
  • PDF/dictogloss.pdf 191.7 kB
  • PDF/did-you-know-that.pdf 498.3 kB
  • PDF/did.pdf 845.7 kB
  • PDF/different-tastes.pdf 89.9 kB
  • PDF/dilemma-what-do-you-consider.pdf 106.8 kB
  • PDF/dinner-time-prepositions.pdf 127.5 kB
  • PDF/dioramas-crayola.pdf 260.6 kB
  • PDF/direct-and-reported-speech-summary.pdf 458.7 kB
  • PDF/direct-speech.pdf 88.9 kB
  • PDF/directindirectspeech.pdf 50.4 kB
  • PDF/directions-7.pdf 230.4 kB
  • PDF/directions-and-places-game.pdf 1.3 MB
  • PDF/directions.pdf 110.2 kB
  • PDF/directons-2.pdf 26.7 kB
  • PDF/Disaster in Japan.pdf 212.5 kB
  • PDF/disasters.pdf 212.2 kB
  • PDF/disastrous-dates.pdf 314.4 kB
  • PDF/discussion-sheet_puff.pdf 88.6 kB
  • PDF/discussion-yelda.pdf 1.1 MB
  • PDF/diy-parts-of-speech-poem.pdf 782.8 kB
  • PDF/diy.pdf 15.8 kB
  • PDF/dlbirthday.pdf 330.7 kB
  • PDF/dlchristmas2.pdf 326.5 kB
  • PDF/dlgoodbye.pdf 181.9 kB
  • PDF/dlhello.pdf 262.4 kB
  • PDF/dlthankyou.pdf 197.8 kB
  • PDF/dlwelcome.pdf 417.1 kB
  • PDF/dlwelcome2.pdf 1.3 MB
  • PDF/do-does-simple-present.pdf 88.3 kB
  • PDF/do-play-go.pdf 459.5 kB
  • PDF/do-you-believe.pdf 37.4 kB
  • PDF/do-you-know-my-name.pdf 280.0 kB
  • PDF/do-you-know-the-alphabet.pdf 127.2 kB
  • PDF/do-you-like-school-s2.pdf 150.1 kB
  • PDF/do-you-like.pdf 32.8 kB
  • PDF/do-you-live-in-a-burglar-friendly-house.pdf 465.5 kB
  • PDF/do-you-want-some-more.pdf 168.1 kB
  • PDF/doc-1.pdf 164.1 kB
  • PDF/doc1.pdf 26.4 kB
  • PDF/doc2.pdf 860.0 kB
  • PDF/doc4.pdf 111.2 kB
  • PDF/doc6.pdf 730.8 kB
  • PDF/dog.pdf 40.4 kB
  • PDF/dogspetselementary.pdf 407.8 kB
  • PDF/dogspetsintermediate.pdf 200.8 kB
  • PDF/dokument1.pdf 49.7 kB
  • PDF/dokument1_001.pdf 65.8 kB
  • PDF/domestic_animals.pdf 272.4 kB
  • PDF/domingo_11nov.pdf 262.4 kB
  • PDF/domino-a-an.pdf 941.5 kB
  • PDF/dominoes.pdf 23.9 kB
  • PDF/dominoes_001.pdf 23.9 kB
  • PDF/dominoes_christmas.pdf 995.0 kB
  • PDF/dont-give-up-song-worksheet.pdf 227.6 kB
  • PDF/dont-lesson.pdf 328.2 kB
  • PDF/dont-worry-be-happy-bobby-mcferrin-fill-in-the.pdf 384.3 kB
  • PDF/dont-worry-child.pdf 272.9 kB
  • PDF/dontgiveup.pdf 288.5 kB
  • PDF/doua-grammar.pdf 211.8 kB
  • PDF/down-by-the-river-with-key.pdf 279.0 kB
  • PDF/Drama Terms.pdf 216.5 kB
  • PDF/drama-activities.pdf 82.7 kB
  • PDF/draw-a-picture.pdf 128.8 kB
  • PDF/draw-the-seaside.pdf 24.9 kB
  • PDF/drawing-on-a-grid.pdf 101.7 kB
  • PDF/dream-job.pdf 169.3 kB
  • PDF/dream.pdf 199.6 kB
  • PDF/dreams.pdf 309.4 kB
  • PDF/dreams_001.pdf 890.3 kB
  • PDF/dreidel-patterns.pdf 281.4 kB
  • PDF/dreidel.pdf 143.2 kB
  • PDF/drink.pdf 216.7 kB
  • PDF/Driving rules and laws.pdf 221.3 kB
  • PDF/dumb-ways-to-die.pdf 38.5 kB
  • PDF/dumb-ways-to-die_001.pdf 209.4 kB
  • PDF/dumb-ways.pdf 36.5 kB
  • PDF/durrell-zoo-webquest-pdf.pdf 235.1 kB
  • PDF/e-mails.pdf 396.7 kB
  • PDF/each-vs-every.pdf 639.9 kB
  • PDF/Earth Day.pdf 208.2 kB
  • PDF/Earth Day_001.pdf 214.2 kB
  • PDF/earth-day-activities.pdf 196.1 kB
  • PDF/earth-day-outdoor-activities.pdf 781.3 kB
  • PDF/earth-day.pdf 223.2 kB
  • PDF/earthday.pdf 536.4 kB
  • PDF/earthquake-book.pdf 4.8 MB
  • PDF/earthquake-poster.pdf 319.0 kB
  • PDF/earthquake-safety-activities.pdf 5.2 MB
  • PDF/east-and-west-pdf.pdf 1.6 MB
  • PDF/Easter Bunny Where are you hiding.pdf 213.6 kB
  • PDF/Easter Double Puzzle.pdf 215.0 kB
  • PDF/Easter Secret Message.pdf 215.4 kB
  • PDF/EASTER WORDSEARCH.pdf 216.4 kB
  • PDF/easter-and-s.pdf 395.4 kB
  • PDF/easter-arts-and-crafts.pdf 3.4 MB
  • PDF/easter-bingo.pdf 672.4 kB
  • PDF/easter-bunny-mask.pdf 61.5 kB
  • PDF/easter-bw.pdf 764.0 kB
  • PDF/easter-crossword-m.pdf 401.7 kB
  • PDF/easter-dice.pdf 124.2 kB
  • PDF/easter-egg-decorate.pdf 156.4 kB
  • PDF/easter-game.pdf 575.1 kB
  • PDF/easter-mc.pdf 796.5 kB
  • PDF/easter-mini.pdf 202.6 kB
  • PDF/easter-picture-crossword.pdf 756.1 kB
  • PDF/easter-poem.pdf 592.7 kB
  • PDF/easter-poster.pdf 569.8 kB
  • PDF/easter-prepositions.pdf 55.6 kB
  • PDF/easter-standup-bunny.pdf 70.5 kB
  • PDF/easter-standup-egg.pdf 79.2 kB
  • PDF/easter-trivia-quiz.pdf 97.2 kB
  • PDF/easter-word-search.pdf 212.6 kB
  • PDF/easter.pdf 206.3 kB
  • PDF/easy-hint-to-improve-your-speech.pdf 505.6 kB
  • PDF/eating-habits.pdf 206.7 kB
  • PDF/eating.pdf 226.5 kB
  • PDF/Ecology Tile Puzzle.pdf 216.8 kB
  • PDF/editing.pdf 47.1 kB
  • PDF/education word search.pdf 220.1 kB
  • PDF/efl.pdf 1.0 MB
  • PDF/ego-song-activity-gradable-adjectives.pdf 32.2 kB
  • PDF/ego-song-activity.pdf 33.7 kB
  • PDF/egypt.pdf 236.8 kB
  • PDF/ej-level-1-lesson-11-subject-object-pronoun.pdf 477.8 kB
  • PDF/el-ponchis-1-hunted-summary.pdf 36.7 kB
  • PDF/el-ponchis-2-captured.pdf 508.7 kB
  • PDF/el-ponchis-3-tried-and-convicted.pdf 116.8 kB
  • PDF/eleanor-rigby.pdf 132.0 kB
  • PDF/electric-match.pdf 621.5 kB
  • PDF/electric.pdf 607.9 kB
  • PDF/electrical-storm.pdf 560.0 kB
  • PDF/electronic-devices.pdf 367.6 kB
  • PDF/Elementary Easter Word Search British.pdf 218.4 kB
  • PDF/Elementary Prepositions of Place Word Search.pdf 215.9 kB
  • PDF/elementary-activity.pdf 159.0 kB
  • PDF/elementary-exam.pdf 100.8 kB
  • PDF/elementary-exercise.pdf 61.0 kB
  • PDF/elementarytest.pdf 189.5 kB
  • PDF/elephant.pdf 271.9 kB
  • PDF/Elizabethan era.pdf 206.5 kB
  • PDF/elmos-guessing-game-book-ppp.pdf 306.0 kB
  • PDF/elton-john-someday-out-of-the-blue.pdf 114.7 kB
  • PDF/elvis-presley.pdf 75.6 kB
  • PDF/emergency-000.pdf 628.8 kB
  • PDF/emigrate.pdf 214.8 kB
  • PDF/emotionalmemories-2.pdf 35.3 kB
  • PDF/emotions.pdf 154.3 kB
  • PDF/empire-state-of-mind-alicia-keys-worksheet.pdf 127.3 kB
  • PDF/end-of-the-world-1.pdf 369.2 kB
  • PDF/end-of-year-letter-2-my-teacher.pdf 172.2 kB
  • PDF/endangered-spices-there-is-there-are-plus-numbers.pdf 269.0 kB
  • PDF/endangered_species.pdf 20.3 kB
  • PDF/endofyear-snapshots.pdf 249.0 kB
  • PDF/energypicturepri-elem.pdf 133.9 kB
  • PDF/england.pdf 336.1 kB
  • PDF/English is everywhere Where can we find it.pdf 212.0 kB
  • PDF/english-is-fun.pdf 296.1 kB
  • PDF/english-lessons-assessment.pdf 223.0 kB
  • PDF/english-quiz-en.pdf 686.0 kB
  • PDF/english-quiz.pdf 60.4 kB
  • PDF/english-superstitions-conditional-1.pdf 332.8 kB
  • PDF/english-superstitions.pdf 224.6 kB
  • PDF/english-telephone.pdf 121.7 kB
  • PDF/english-test-5th-grade-january.pdf 489.7 kB
  • PDF/english-test-basic.pdf 545.5 kB
  • PDF/english-test-common-expressions-answers.pdf 22.7 kB
  • PDF/english-test-common-expressions.pdf 22.3 kB
  • PDF/english-test-nouns.pdf 40.2 kB
  • PDF/english-test.pdf 259.2 kB
  • PDF/english-today-test.pdf 87.7 kB
  • PDF/english-town-information-gap-game.pdf 275.7 kB
  • PDF/english-with-jonnnik-groundhog.pdf 657.5 kB
  • PDF/english-with-jonnnik-st-vl.pdf 1.3 MB
  • PDF/english-with-jonnnik-val-day.pdf 89.4 kB
  • PDF/english-with-jonnnik.pdf 421.0 kB
  • PDF/english-worksheet-past-simple-wh-questions.pdf 239.0 kB
  • PDF/english-worksheet_-the-beatles.pdf 404.5 kB
  • PDF/english_lesson_planaugust27-1th.pdf 122.0 kB
  • PDF/english_proverbs_and_sayings.pdf 672.2 kB
  • PDF/english_proverbs_and_sayings_001.pdf 672.2 kB
  • PDF/english_speaking_countries_quiz.pdf 40.6 kB
  • PDF/englishproverbs.pdf 230.0 kB
  • PDF/enjoying-your-home.pdf 824.2 kB
  • PDF/entry-test.pdf 129.5 kB
  • PDF/envelope.pdf 95.6 kB
  • PDF/environ1.pdf 534.0 kB
  • PDF/environment-cw-2003.pdf 320.3 kB
  • PDF/environment-voc-st-2003.pdf 408.3 kB
  • PDF/environment-wordsearch.pdf 987.4 kB
  • PDF/Environment.pdf 215.7 kB
  • PDF/Environmental Double Puzzle.pdf 214.9 kB
  • PDF/environmental-threats-intro.pdf 71.8 kB
  • PDF/episode-3-season-3-bt.pdf 207.2 kB
  • PDF/error-correction-help-gianni-with-his-english.pdf 31.5 kB
  • PDF/error_smasher.pdf 28.6 kB
  • PDF/error_smasher_001.pdf 28.6 kB
  • PDF/esl-2.pdf 372.1 kB
  • PDF/esl-fruit-vocabulary.pdf 759.7 kB
  • PDF/eslprintables200812283537612122491.pdf 67.1 kB
  • PDF/essays-made-easy.pdf 49.6 kB
  • PDF/essaytag.pdf 65.2 kB
  • PDF/eternal-flame.pdf 45.9 kB
  • PDF/euphemisms-handout.pdf 208.0 kB
  • PDF/euthanasia-nl.pdf 112.3 kB
  • PDF/eva-longoria.pdf 430.1 kB
  • PDF/evanescence.pdf 195.8 kB
  • PDF/everlong-foo-fighters.pdf 167.0 kB
  • PDF/every-breath-you-take-the-police.pdf 76.1 kB
  • PDF/every-day-activities-3my.pdf 940.4 kB
  • PDF/everybody-talks.pdf 125.2 kB
  • PDF/everybodys-changing.pdf 180.9 kB
  • PDF/everyday-expressions.pdf 47.9 kB
  • PDF/everyday-game-n.pdf 1.3 MB
  • PDF/everyday-idioms.pdf 2.3 MB
  • PDF/everyday-items-bingo.pdf 655.8 kB
  • PDF/everything-at-once-lenka.pdf 61.4 kB
  • PDF/everything-at-once-lnka.pdf 339.4 kB
  • PDF/everything-you-want-exercises.pdf 507.9 kB
  • PDF/everytime-we-touch-worksheet.pdf 755.8 kB
  • PDF/eviu_lpi-i_test_vocabtest.pdf 57.6 kB
  • PDF/exam-cheats-new.pdf 9.9 MB
  • PDF/exam1.pdf 91.0 kB
  • PDF/except-for-the-turkey-thanksgiving-worksheet.pdf 277.8 kB
  • PDF/exercise-1.pdf 67.3 kB
  • PDF/exercise-adverbs-of-degree.pdf 57.0 kB
  • PDF/exercise_bridge-of-light.pdf 48.7 kB
  • PDF/exercises-for-elementary-students-2.pdf 95.9 kB
  • PDF/exercises-for-elementary-students.pdf 103.9 kB
  • PDF/exercises-for-the-lesson.pdf 90.7 kB
  • PDF/exercises-going-to-will-pr-cont.pdf 61.2 kB
  • PDF/exercises-possessive-adjectives.pdf 47.3 kB
  • PDF/exhausted.pdf 233.1 kB
  • PDF/exploring-scotland.pdf 197.5 kB
  • PDF/expository.pdf 1.6 MB
  • PDF/expressing-future-will-be-going-to.pdf 730.9 kB
  • PDF/expressing-future.pdf 270.0 kB
  • PDF/expressingobligationwithschedulesactivity.pdf 305.0 kB
  • PDF/expressions_of_quantity.pdf 1.6 MB
  • PDF/extra-activities-school-object-1st-children.pdf 1.1 MB
  • PDF/extra-do-does-have-has-is.pdf 40.6 kB
  • PDF/Extreme sports.pdf 212.0 kB
  • PDF/extreme-sports.pdf 270.6 kB
  • PDF/eye-contact-domino.pdf 352.2 kB
  • PDF/f2-thurs-28-feb.pdf 374.4 kB
  • PDF/fa-176.pdf 1.3 MB
  • PDF/fa-176_001.pdf 1.3 MB
  • PDF/fa-285.pdf 576.8 kB
  • PDF/fa-295-press.pdf 2.4 MB
  • PDF/fa-295-press_001.pdf 2.4 MB
  • PDF/fa2010105140.pdf 305.0 kB
  • PDF/fa_327.pdf 3.8 MB
  • PDF/face.pdf 296.9 kB
  • PDF/facts-about-mother-russia.pdf 81.1 kB
  • PDF/facts.pdf 77.0 kB
  • PDF/fairy-flashcards.pdf 3.2 MB
  • PDF/fairy-tale-characters.pdf 393.2 kB
  • PDF/fairy-tales-board-game-final.pdf 231.2 kB
  • PDF/fairy-tales-titles-new-1.pdf 121.1 kB
  • PDF/fairy-tales.pdf 303.6 kB
  • PDF/fairy-tales_001.pdf 2.6 MB
  • PDF/fairytales.pdf 1.7 MB
  • PDF/fam-day-wordsearch-elem.pdf 44.9 kB
  • PDF/families-co-elllo-613-correction.pdf 45.7 kB
  • PDF/Family Relations.pdf 218.2 kB
  • PDF/Family ties.pdf 212.4 kB
  • PDF/FAMILY VOCABULARY.pdf 211.9 kB
  • PDF/family-2.pdf 138.8 kB
  • PDF/family-cards.pdf 32.2 kB
  • PDF/family-cards_001.pdf 138.9 kB
  • PDF/family-day-trivia.pdf 123.8 kB
  • PDF/family-life.pdf 682.2 kB
  • PDF/family-matters.pdf 220.2 kB
  • PDF/family-members-simpsons.pdf 107.7 kB
  • PDF/family-topic.pdf 130.8 kB
  • PDF/family-tree-4-printing.pdf 263.0 kB
  • PDF/family-tree.pdf 301.4 kB
  • PDF/family-tree_001.pdf 267.7 kB
  • PDF/family-vocabpossessive-s.pdf 214.4 kB
  • PDF/Family.pdf 217.9 kB
  • PDF/family1.pdf 496.4 kB
  • PDF/family1_001.pdf 271.0 kB
  • PDF/family_001.pdf 149.7 kB
  • PDF/family_002.pdf 100.7 kB
  • PDF/family_003.pdf 309.6 kB
  • PDF/family_tree.pdf 58.3 kB
  • PDF/famous-5a.pdf 250.6 kB
  • PDF/famous-couples-in-british-literature.pdf 53.1 kB
  • PDF/famous-landmarks-in-india.pdf 1.4 MB
  • PDF/famous-movie-quotes-part-1-reported-speech.pdf 430.9 kB
  • PDF/famous-movie-quotes-part-2-reported-speech.pdf 460.0 kB
  • PDF/famous-people-cards.pdf 200.0 kB
  • PDF/famous-people-crossword.pdf 72.6 kB
  • PDF/famous-people.pdf 167.1 kB
  • PDF/famous-people_001.pdf 39.1 kB
  • PDF/famous-women-concentration.pdf 383.0 kB
  • PDF/famous_places_in_ukraine.pdf 488.8 kB
  • PDF/fantasy-and-fairy-tales.pdf 765.3 kB
  • PDF/farm-animals-98.pdf 233.7 kB
  • PDF/farm-animals-missing.pdf 392.0 kB
  • PDF/farm-animals-picture-crossword.pdf 603.8 kB
  • PDF/farm-animals.pdf 740.6 kB
  • PDF/father-and-son.pdf 258.3 kB
  • PDF/father-and-son_001.pdf 258.3 kB
  • PDF/father-christmas-clock.pdf 39.4 kB
  • PDF/fathers-day-badge.pdf 146.3 kB
  • PDF/fathers-day-briefcase.pdf 173.1 kB
  • PDF/fathers-day-cards.pdf 215.3 kB
  • PDF/fathers-day-certificate.pdf 169.6 kB
  • PDF/fathers-day-creative-writing.pdf 168.3 kB
  • PDF/fathers-day-keys-for-dad.pdf 163.5 kB
  • PDF/fathers-day-my-dad-special.pdf 178.5 kB
  • PDF/fathers-day-pocket.pdf 235.3 kB
  • PDF/favorite-celebrity.pdf 1.9 MB
  • PDF/favorite-fruits.pdf 610.0 kB
  • PDF/favorite-pastimes-bingo-sheet.pdf 191.9 kB
  • PDF/favorite_taste.pdf 58.5 kB
  • PDF/fawlty-towers-checking-in-answers.pdf 382.6 kB
  • PDF/fawlty-towers-checking-in.pdf 380.7 kB
  • PDF/fawlty-towers-season-one-worksheets.pdf 61.5 kB
  • PDF/fb-colours.pdf 209.3 kB
  • PDF/fce.pdf 66.2 kB
  • PDF/feb-2011-legal-exam-paper.pdf 232.1 kB
  • PDF/feb-calendar.pdf 547.4 kB
  • PDF/feeling-the-music-lesson-plan.pdf 649.0 kB
  • PDF/Feelings - How may you feel.pdf 212.5 kB
  • PDF/Feelings and Emotions Beginners Word Search.pdf 219.8 kB
  • PDF/feelings-flashcards21012.pdf 208.9 kB
  • PDF/feelings-mc.pdf 199.7 kB
  • PDF/feelings-picture-2012.pdf 322.7 kB
  • PDF/Feelings.pdf 218.1 kB
  • PDF/feelings_001.pdf 500.1 kB
  • PDF/FEELINGS_002.pdf 220.2 kB
  • PDF/feelings_003.pdf 250.9 kB
  • PDF/feelings_004.pdf 818.2 kB
  • PDF/feelings_disasters.pdf 60.1 kB
  • PDF/felix-baumgartner.pdf 126.3 kB
  • PDF/ferris-bueller.pdf 150.9 kB
  • PDF/festivals.pdf 2.1 MB
  • PDF/fictional-text.pdf 657.4 kB
  • PDF/fierce-snake-fact-sheet.pdf 149.0 kB
  • PDF/fill-in-one.pdf 59.5 kB
  • PDF/fill-in-the-blanks-18.pdf 72.9 kB
  • PDF/fill-in-the-gaps-the-notebook.pdf 74.1 kB
  • PDF/fill-in-the-verbs.pdf 105.5 kB
  • PDF/filling-in-the-form.pdf 46.3 kB
  • PDF/Film Vocabulary.pdf 220.2 kB
  • PDF/film-buffy-the-vampire-slayer-s04e10-hush.pdf 381.8 kB
  • PDF/film-enough-worksheet.pdf 553.7 kB
  • PDF/filthy-cities-comprehension-london.pdf 40.3 kB
  • PDF/filthy-cities-comprehension.pdf 214.1 kB
  • PDF/final-test4.pdf 214.3 kB
  • PDF/finalhnyyabc.pdf 3.9 MB
  • PDF/find-someone-who-adjectives.pdf 38.0 kB
  • PDF/find-someone-who-after-summer-holidays.pdf 1.4 MB
  • PDF/find-someone-who-ov.pdf 7.5 kB
  • PDF/find-someone-who-print.pdf 123.7 kB
  • PDF/find-someone-who-sports-2nd-grade.pdf 25.1 kB
  • PDF/find-someone-who-to-be.pdf 172.6 kB
  • PDF/find-someone-who.pdf 105.6 kB
  • PDF/find-someone-who_001.pdf 105.4 kB
  • PDF/find-someone-who_002.pdf 104.5 kB
  • PDF/find-the-homophones.pdf 45.5 kB
  • PDF/find-words.pdf 33.9 kB
  • PDF/find-your-peer-warm-up-activity.pdf 36.7 kB
  • PDF/finish-the-sentence-speaking-activity.pdf 51.8 kB
  • PDF/firends-season-2-episode-8-the-one-with-the-list.pdf 66.2 kB
  • PDF/firework.pdf 120.2 kB
  • PDF/firework_001.pdf 61.8 kB
  • PDF/First Day in London.pdf 220.3 kB
  • PDF/first-conditional-2012.pdf 450.3 kB
  • PDF/first-conditional.pdf 688.5 kB
  • PDF/first-conditional_001.pdf 500.9 kB
  • PDF/first-day-games.pdf 20.9 kB
  • PDF/first-day-stress.pdf 2.5 MB
  • PDF/first-pages.pdf 1.6 MB
  • PDF/first-week-ideas.pdf 296.4 kB
  • PDF/first.pdf 131.1 kB
  • PDF/firstcertificatespeakingandwritingsample.pdf 1.7 MB
  • PDF/firstcertificatespeakingandwritingsample_001.pdf 1.7 MB
  • PDF/five-senses-worksheet.pdf 57.8 kB
  • PDF/flag-day-1.pdf 144.5 kB
  • PDF/flag-day-respecting.pdf 164.8 kB
  • PDF/flag-day.pdf 351.5 kB
  • PDF/flag.pdf 75.3 kB
  • PDF/flag_001.pdf 205.7 kB
  • PDF/flagday-pledge.pdf 155.3 kB
  • PDF/flagday.pdf 62.8 kB
  • PDF/flash-cards-verbs.pdf 1.6 MB
  • PDF/flash-cards.pdf 691.7 kB
  • PDF/flash-cards_plural.pdf 1.1 MB
  • PDF/flash-christmas-1.pdf 1.0 MB
  • PDF/flash-christmas.pdf 306.1 kB
  • PDF/flashcards-identities.pdf 12.4 kB
  • PDF/Flat.pdf 214.8 kB
  • PDF/flee-market.pdf 137.3 kB
  • PDF/flowers-job.pdf 240.7 kB
  • PDF/flowers.pdf 2.4 MB
  • PDF/folktales.pdf 913.1 kB
  • PDF/follow-simple-instruction-tasks.pdf 32.6 kB
  • PDF/Food and Drink Wordsearch.pdf 220.4 kB
  • PDF/Food Elementary Word Search.pdf 212.0 kB
  • PDF/FOOD Word Search.pdf 219.9 kB
  • PDF/Food Word search_001.pdf 217.9 kB
  • PDF/food-2011.pdf 1.1 MB
  • PDF/food-2012.pdf 411.3 kB
  • PDF/food-21.pdf 555.1 kB
  • PDF/food-activity.pdf 645.8 kB
  • PDF/food-advanced-learners.pdf 211.6 kB
  • PDF/food-and-drinks.pdf 50.0 kB
  • PDF/food-and-drinks_001.pdf 439.3 kB
  • PDF/food-basic-conversation.pdf 147.9 kB
  • PDF/food-board-game.pdf 373.2 kB
  • PDF/food-board-game_001.pdf 387.5 kB
  • PDF/food-containers.pdf 1.4 MB
  • PDF/food-counters.pdf 11.9 kB
  • PDF/food-crossword-2011.pdf 596.3 kB
  • PDF/food-crossword-2012.pdf 234.5 kB
  • PDF/food-exercises.pdf 1.7 MB
  • PDF/food-expressions.pdf 1.1 MB
  • PDF/food-idioms-worksheet.pdf 276.8 kB
  • PDF/food-idioms.pdf 755.2 kB
  • PDF/food-idioms_001.pdf 132.6 kB
  • PDF/food-matching.pdf 563.7 kB
  • PDF/food-matching_001.pdf 255.8 kB
  • PDF/food-missing.pdf 152.2 kB
  • PDF/food-pair-work-matching-game.pdf 490.1 kB
  • PDF/food-picture-dictionary.pdf 318.9 kB
  • PDF/food-pictures.pdf 1.9 MB
  • PDF/food-powerpoint.pdf 988.0 kB
  • PDF/food-snap.pdf 526.4 kB
  • PDF/food-vocabularyspeaking-cards.pdf 1.4 MB
  • PDF/food-word-jumbles.pdf 2.2 MB
  • PDF/food-word-search.pdf 256.0 kB
  • PDF/food-wordsearch.pdf 29.9 kB
  • PDF/FOOD.pdf 209.2 kB
  • PDF/food1.pdf 702.5 kB
  • PDF/food212.pdf 734.8 kB
  • PDF/Food_001.pdf 216.4 kB
  • PDF/Food_002.pdf 217.0 kB
  • PDF/food_con_cards.pdf 121.3 kB
  • PDF/food_gameprepositions.pdf 35.3 kB
  • PDF/food_gameprepositions_001.pdf 35.3 kB
  • PDF/food_vocabulary.pdf 152.8 kB
  • PDF/foodgloriousfood.pdf 1.8 MB
  • PDF/foodsyoulikecopy.pdf 103.6 kB
  • PDF/football-quiz.pdf 805.3 kB
  • PDF/footwear-accessories.pdf 382.3 kB
  • PDF/for-and-since-for-time.pdf 55.3 kB
  • PDF/for-since-or-ago.pdf 356.3 kB
  • PDF/forgot.pdf 210.6 kB
  • PDF/formaci_n_de_plurales.pdf 41.5 kB
  • PDF/formal-versus-informal-no-logo.pdf 67.8 kB
  • PDF/formes-personnelle-et-cas-possessif.pdf 31.8 kB
  • PDF/fortune-teller.pdf 175.2 kB
  • PDF/fortune-teller2.pdf 583.0 kB
  • PDF/fox-in-socks.pdf 260.0 kB
  • PDF/fragments-run-on.pdf 679.4 kB
  • PDF/frank-sinatra-new-york.pdf 74.9 kB
  • PDF/freaky-friday-worksheet.pdf 82.1 kB
  • PDF/free.pdf 289.1 kB
  • PDF/freeze.pdf 241.5 kB
  • PDF/frequency-adverbs-board-game.pdf 618.0 kB
  • PDF/frequency-cards.pdf 1.2 MB
  • PDF/frequencyadverbs.pdf 233.3 kB
  • PDF/friend.pdf 67.7 kB
  • PDF/friends-6x09.pdf 460.6 kB
  • PDF/friends-halloween-episode.pdf 115.6 kB
  • PDF/friends-season-2-episode-10-the-one-with-the-russ.pdf 70.9 kB
  • PDF/friends-season-2-episode-11-the-one-with-the.pdf 72.6 kB
  • PDF/friends-season-2-episode-12.pdf 121.3 kB
  • PDF/friends-season-2-episode-14.pdf 100.6 kB
  • PDF/friends-season-2-episode-16.pdf 156.5 kB
  • PDF/friends-season-2-episode-9-the-one-with-phoebes.pdf 237.1 kB
  • PDF/friends-video-session-joey-and-ross-dating-the.pdf 29.1 kB
  • PDF/friends.pdf 498.4 kB
  • PDF/friendsepisodeabouthotels.pdf 106.9 kB
  • PDF/frog-and-toad-the-garden-worksheet.pdf 166.1 kB
  • PDF/frog-cycle.pdf 12.4 kB
  • PDF/from-the-elephant-song_present-simple-pos-and-neg.pdf 46.6 kB
  • PDF/FRUIT AND VEGETABLES.pdf 211.8 kB
  • PDF/fruit-and-vegetables-bw.pdf 963.9 kB
  • PDF/fruit-crossword.pdf 666.1 kB
  • PDF/fruit-flashcards-2012.pdf 346.7 kB
  • PDF/fruit-matching-2012.pdf 365.3 kB
  • PDF/fruit.pdf 1.1 MB
  • PDF/fruit_001.pdf 306.2 kB
  • PDF/fruit_memory-game.pdf 232.0 kB
  • PDF/fruit_vocabulary.pdf 92.3 kB
  • PDF/Fruits and Vegetables.pdf 215.6 kB
  • PDF/fruits-and-vegetables.pdf 736.5 kB
  • PDF/fruits-and-vegetables_001.pdf 748.5 kB
  • PDF/fruits-boardgame.pdf 340.0 kB
  • PDF/fruits-missing.pdf 1.8 MB
  • PDF/fruitsvegetables.pdf 399.2 kB
  • PDF/fs1-oral-partiel-first-semester-2012.pdf 48.2 kB
  • PDF/fukusima.pdf 667.9 kB
  • PDF/fullbreakfast.pdf 949.9 kB
  • PDF/funbook-transportation.pdf 3.6 MB
  • PDF/functional-language-opinions.pdf 221.7 kB
  • PDF/functions-bank.pdf 66.2 kB
  • PDF/functions-of-money.pdf 249.0 kB
  • PDF/funfacts.pdf 75.1 kB
  • PDF/funny-language.pdf 1.1 MB
  • PDF/funny.pdf 25.5 kB
  • PDF/funnyinventionspictures.pdf 291.6 kB
  • PDF/Furniture and decoration.pdf 216.1 kB
  • PDF/Furniture and things.pdf 220.2 kB
  • PDF/furniture-and-house.pdf 220.5 kB
  • PDF/furniture-prepositions-cut-and-stick.pdf 282.1 kB
  • PDF/Furniture.pdf 212.2 kB
  • PDF/furniture_worksheet_full.pdf 172.7 kB
  • PDF/future-2012.pdf 902.8 kB
  • PDF/future-career.pdf 252.8 kB
  • PDF/future-continuous.pdf 96.3 kB
  • PDF/future-forms-in-english.pdf 722.9 kB
  • PDF/future-forms.pdf 405.3 kB
  • PDF/future-forms_001.pdf 755.9 kB
  • PDF/future-forms_002.pdf 65.7 kB
  • PDF/future-perfect.pdf 83.6 kB
  • PDF/future-predictions_will_going-to_might.pdf 189.9 kB
  • PDF/future-simple.pdf 46.8 kB
  • PDF/future-talk.pdf 139.8 kB
  • PDF/future-tense.pdf 68.4 kB
  • PDF/future-will.pdf 88.2 kB
  • PDF/future.pdf 241.5 kB
  • PDF/ga_africainfo8.pdf 159.2 kB
  • PDF/gail-devers-copia.pdf 1.6 MB
  • PDF/game-prepositions.pdf 238.3 kB
  • PDF/game-who-what.pdf 116.5 kB
  • PDF/game_st_patrick.pdf 333.5 kB
  • PDF/games-sample1.pdf 68.4 kB
  • PDF/games_and_activites-for-teachers.pdf 112.0 kB
  • PDF/gap-year-students.pdf 224.7 kB
  • PDF/garage.pdf 365.0 kB
  • PDF/garden.pdf 1.2 MB
  • PDF/garfield-worksheet.pdf 334.2 kB
  • PDF/gary-video-sheet.pdf 42.9 kB
  • PDF/genitives.pdf 75.2 kB
  • PDF/Geniuses in History.pdf 220.1 kB
  • PDF/genre-book-cover-project-12sep12.pdf 164.5 kB
  • PDF/geographyoftheusa.pdf 891.4 kB
  • PDF/Germs germs everywhere.pdf 216.4 kB
  • PDF/gerund-and-infinitive.pdf 138.8 kB
  • PDF/gerund-or-infinitive-review.pdf 191.7 kB
  • PDF/gerund-or-infinitive.pdf 298.3 kB
  • PDF/gerund-or-infinitive_001.pdf 42.8 kB
  • PDF/gerund-or-infintive-happy-new-years.pdf 69.3 kB
  • PDF/gerund-vs-infinitive.pdf 40.5 kB
  • PDF/gerunds-or-infinitives.pdf 27.7 kB
  • PDF/get-that-job.pdf 1.1 MB
  • PDF/get-your-prepositions-right.pdf 28.7 kB
  • PDF/getting-to-know-my-students-1st-class.pdf 412.4 kB
  • PDF/getting-to-know-you.pdf 21.7 kB
  • PDF/getting-to-know-your-classmates-superlatives.pdf 70.4 kB
  • PDF/giant-summer-glasses.pdf 33.2 kB
  • PDF/gifted-hands2.pdf 128.7 kB
  • PDF/gingerbread-man-handout-2nd.pdf 27.8 kB
  • PDF/girl-on-fire-by-alicia-keys.pdf 157.6 kB
  • PDF/give-personal-information.pdf 74.8 kB
  • PDF/give-your-advice.pdf 26.2 kB
  • PDF/giving-advice.pdf 113.4 kB
  • PDF/giving-advice_001.pdf 32.6 kB
  • PDF/giving-advice_cards_2013.pdf 14.4 kB
  • PDF/giving-opinions-about-everyday-annoyances.pdf 21.6 kB
  • PDF/giving-opinions.pdf 34.9 kB
  • PDF/giving_complements.pdf 34.1 kB
  • PDF/glad-you-came1.pdf 59.8 kB
  • PDF/glad-you-came_complete.pdf 83.1 kB
  • PDF/Go Green.pdf 215.3 kB
  • PDF/go-alone-and-find-yourself.pdf 317.0 kB
  • PDF/go-fish_color.pdf 5.7 MB
  • PDF/Going Green.pdf 219.2 kB
  • PDF/going-to-future-diary-entry-act.pdf 1.5 kB
  • PDF/going-to-the-doctor.pdf 32.3 kB
  • PDF/gold.pdf 255.7 kB
  • PDF/good-night-mr-bean-video-activity.pdf 75.8 kB
  • PDF/good-pet.pdf 2.4 MB
  • PDF/good-time-owl-city-song.pdf 53.3 kB
  • PDF/goodbchart.pdf 292.0 kB
  • PDF/gorillas-know-how-to-use-apostrophes.pdf 1.2 MB
  • PDF/gossip.pdf 256.8 kB
  • PDF/gotta-be.pdf 276.8 kB
  • PDF/gotye-somebody-i-used-to-know.pdf 101.8 kB
  • PDF/gotye-somebody-that-i-used-to-know.pdf 41.1 kB
  • PDF/gotye.pdf 277.1 kB
  • PDF/gr-1-worksheet-more-or-less.pdf 599.2 kB
  • PDF/gr-q3.pdf 115.4 kB
  • PDF/gra-planszowa1a-c.pdf 279.3 kB
  • PDF/gra-planszowa1a-c_001.pdf 279.3 kB
  • PDF/gradable non gradable adjectives.pdf 212.4 kB
  • PDF/grade-3-lesson-1.pdf 3.2 MB
  • PDF/grade-3-spelling-book.pdf 836.3 kB
  • PDF/grammar-and-vocab-test-for-esl-learners.pdf 26.0 kB
  • PDF/grammar-assessment.pdf 186.2 kB
  • PDF/grammar-bingo.pdf 43.6 kB
  • PDF/grammar-exam-pre-int.pdf 44.9 kB
  • PDF/grammar-exercises.pdf 82.2 kB
  • PDF/grammar-must-mustnt.pdf 175.5 kB
  • PDF/grammar-present-simple.pdf 24.4 kB
  • PDF/grammar-present-simple_001.pdf 82.9 kB
  • PDF/grammar-review-elementary-.pdf 153.5 kB
  • PDF/grammar-review_past_comparative.pdf 48.0 kB
  • PDF/grammar-revision.pdf 409.4 kB
  • PDF/grammar-test.pdf 534.7 kB
  • PDF/grammar-words.pdf 14.0 kB
  • PDF/grammar.pdf 1.3 MB
  • PDF/grammar_presentsimple_elem_esl-2nd-hidh-school.pdf 80.8 kB
  • PDF/grammar_summary.pdf 164.3 kB
  • PDF/grammarreview.pdf 66.6 kB
  • PDF/Great Britain Puzzle.pdf 214.9 kB
  • PDF/great-explorers-mine.pdf 318.0 kB
  • PDF/great-people-matching.pdf 311.1 kB
  • PDF/greatest.pdf 264.6 kB
  • PDF/Greek and Roman Gods Word Search.pdf 220.8 kB
  • PDF/green-eyes.pdf 267.8 kB
  • PDF/green-lantern.pdf 226.6 kB
  • PDF/greeting.pdf 787.7 kB
  • PDF/Greetings and Introductions .pdf 219.7 kB
  • PDF/greetings-and-farewells.pdf 195.6 kB
  • PDF/greetings_manners_conversation.pdf 61.1 kB
  • PDF/greg-granger-gave-gretta-green-grapes.pdf 18.0 kB
  • PDF/groundhog-day.pdf 372.3 kB
  • PDF/groundhog-weather-compound-wrds-reader.pdf 374.7 kB
  • PDF/groundhogs-day-new.pdf 571.3 kB
  • PDF/groundhogs-worksheet.pdf 94.5 kB
  • PDF/growing-up.pdf 149.9 kB
  • PDF/gsl-the-general-service-list-by-michael-west-1953.pdf 405.9 kB
  • PDF/gtky-magazine-covers.pdf 1.2 MB
  • PDF/guess-the-colours.pdf 90.2 kB
  • PDF/guess-the-title.pdf 46.5 kB
  • PDF/guess-who-boys.pdf 446.2 kB
  • PDF/guess-who-girls.pdf 424.9 kB
  • PDF/guess-who-questions.pdf 83.4 kB
  • PDF/guess-who.pdf 210.6 kB
  • PDF/habits-for-children-final.pdf 1.5 MB
  • PDF/hair-styles.pdf 2.5 MB
  • PDF/hair-stylesdescriptions.pdf 483.4 kB
  • PDF/hallowee.pdf 201.0 kB
  • PDF/halloween-2011-flashcards.pdf 1.8 MB
  • PDF/halloween-2011.pdf 809.2 kB
  • PDF/halloween-5-days.pdf 124.0 kB
  • PDF/halloween-arts-and-crafts.pdf 2.0 MB
  • PDF/halloween-boardgame.pdf 1.2 MB
  • PDF/halloween-bookmarks.pdf 657.1 kB
  • PDF/halloween-cards-2012.pdf 881.9 kB
  • PDF/halloween-cards.pdf 797.0 kB
  • PDF/halloween-case-study.pdf 379.9 kB
  • PDF/halloween-dice.pdf 182.0 kB
  • PDF/halloween-dominoes.pdf 417.0 kB
  • PDF/halloween-game.pdf 647.7 kB
  • PDF/halloween-game_001.pdf 759.3 kB
  • PDF/halloween-haunted-house-draw.pdf 131.3 kB
  • PDF/halloween-label.pdf 433.6 kB
  • PDF/halloween-matching.pdf 101.9 kB
  • PDF/halloween-math.pdf 558.3 kB
  • PDF/halloween-memory-game.pdf 317.3 kB
  • PDF/halloween-mini-book.pdf 569.7 kB
  • PDF/halloween-missing.pdf 20.1 kB
  • PDF/halloween-myths-.pdf 1.3 MB
  • PDF/halloween-pictionary.pdf 214.2 kB
  • PDF/halloween-poster.pdf 482.9 kB
  • PDF/halloween-s322ownik-obrazkowy.pdf 424.5 kB
  • PDF/halloween-the-skeleton-dance-step-by-step.pdf 134.8 kB
  • PDF/halloween-vs-bonfire-night.pdf 132.0 kB
  • PDF/halloween-workshop.pdf 109.5 kB
  • PDF/halloween.pdf 410.1 kB
  • PDF/halloween1.pdf 354.8 kB
  • PDF/halloween1_001.pdf 354.8 kB
  • PDF/halloween1_wordsearch.pdf 878.0 kB
  • PDF/halloween1_wordsearch_001.pdf 878.0 kB
  • PDF/halloween_001.pdf 560.8 kB
  • PDF/halloween_002.pdf 218.6 kB
  • PDF/halloween_003.pdf 151.8 kB
  • PDF/halloween_004.pdf 683.1 kB
  • PDF/halloween_005.pdf 349.2 kB
  • PDF/halloween_006.pdf 155.8 kB
  • PDF/halloween_007.pdf 142.1 kB
  • PDF/halloween_aberta_efii.pdf 113.1 kB
  • PDF/halloween_listening.pdf 74.1 kB
  • PDF/halloween_present-simple_2012.pdf 474.1 kB
  • PDF/hampton_court_questionnaire_e.pdf 1.2 MB
  • PDF/hand-in-my-pocket.pdf 116.6 kB
  • PDF/handout_numbers.pdf 419.6 kB
  • PDF/handouts.pdf 6.6 MB
  • PDF/handwashing.pdf 331.6 kB
  • PDF/handy-coloringbook2.pdf 151.8 kB
  • PDF/hanukkah-promise-card-patterns.pdf 98.6 kB
  • PDF/happiness.pdf 163.0 kB
  • PDF/happy-dollars.pdf 46.0 kB
  • PDF/happy-easter.pdf 799.4 kB
  • PDF/happy-elephants-test.pdf 40.4 kB
  • PDF/happy-families.pdf 437.8 kB
  • PDF/happy-mothers-day-scavenger-hunt.pdf 294.9 kB
  • PDF/happy-new-year-croos.pdf 555.3 kB
  • PDF/happy-valentines.pdf 61.1 kB
  • PDF/happy.pdf 933.7 kB
  • PDF/happy_001.pdf 189.7 kB
  • PDF/harriet-tubman.pdf 3.4 MB
  • PDF/harry-homophone.pdf 38.7 kB
  • PDF/harryspotterplay.pdf 49.3 kB
  • PDF/have-got-speaking-cards.pdf 539.8 kB
  • PDF/have-got-to-be.pdf 486.8 kB
  • PDF/have-got.pdf 87.9 kB
  • PDF/have-got_has-got_personal-descriptions.pdf 79.5 kB
  • PDF/have-or-has.pdf 1.9 MB
  • PDF/have-to-can.pdf 37.3 kB
  • PDF/have-to-doesnt-have-to-worksheet.pdf 240.8 kB
  • PDF/have-to-job-cards.pdf 21.6 kB
  • PDF/have-to-worksheet.pdf 350.4 kB
  • PDF/have-to.pdf 53.1 kB
  • PDF/have-you-ever-interviews-plus-revision-of-present.pdf 54.2 kB
  • PDF/have-you-ever.pdf 1.1 MB
  • PDF/have-you-ever_-_.pdf 170.9 kB
  • PDF/have.pdf 1.4 MB
  • PDF/havent-met-you-yet.pdf 58.2 kB
  • PDF/hazard.pdf 153.4 kB
  • PDF/headline-vocabulary.pdf 76.7 kB
  • PDF/HeadsUp-Student-Yr1.pdf 16.9 MB
  • PDF/headsup-student-yr2.pdf 4.4 MB
  • PDF/headsup-teacher-yr1.pdf 2.6 MB
  • PDF/headsup-teacher-yr2.pdf 557.8 kB
  • PDF/heal-me-warmer.pdf 21.7 kB
  • PDF/Health Puzzle.pdf 214.9 kB
  • PDF/health-2.pdf 1.1 MB
  • PDF/health-and-sickness.pdf 27.9 kB
  • PDF/health-problems.pdf 412.0 kB
  • PDF/health-vocabulary.pdf 154.0 kB
  • PDF/healthy-food-test-de-compr233hension-233crite.pdf 425.2 kB
  • PDF/healthy-habits.pdf 220.1 kB
  • PDF/healthy_teeth.pdf 16.2 kB
  • PDF/hello-muddah_camp-granada.pdf 335.9 kB
  • PDF/help-libby.pdf 428.6 kB
  • PDF/help-station-posters.pdf 703.2 kB
  • PDF/help.pdf 167.3 kB
  • PDF/here-to-becompostion-describing-a-place.pdf 526.6 kB
  • PDF/here-with-me-busy-teacher-worksheet.pdf 40.2 kB
  • PDF/hey-jude-imperatives.pdf 62.5 kB
  • PDF/hickory.pdf 254.5 kB
  • PDF/high-numbers-worksheet.pdf 388.3 kB
  • PDF/high-school-never-ends-song-questions.pdf 48.2 kB
  • PDF/high-school-text-and-questions.pdf 62.3 kB
  • PDF/highschool-musical.pdf 50.4 kB
  • PDF/highschool-text-and-questions.pdf 105.5 kB
  • PDF/hiring-a-car-pairwork.pdf 86.0 kB
  • PDF/his-her.pdf 157.2 kB
  • PDF/history-quiz.pdf 25.4 kB
  • PDF/hnyyvdstreamer.pdf 521.5 kB
  • PDF/ho-hey.pdf 68.4 kB
  • PDF/ho_family.pdf 404.4 kB
  • PDF/hobbies.pdf 412.8 kB
  • PDF/hobbies_cards.pdf 14.0 kB
  • PDF/hoi-polloi-the-3-stooges.pdf 100.7 kB
  • PDF/holiday-activities-elementary-word-search.pdf 207.6 kB
  • PDF/holiday-gifttags.pdf 284.4 kB
  • PDF/holiday-word-search.pdf 224.9 kB
  • PDF/Holiday.pdf 215.4 kB
  • PDF/holiday_001.pdf 220.3 kB
  • PDF/holiday_002.pdf 1.6 MB
  • PDF/holidaypostcard-toclassmate-lepold.pdf 55.2 kB
  • PDF/holidays.pdf 295.5 kB
  • PDF/holidays_001.pdf 228.3 kB
  • PDF/home-remedies.pdf 765.9 kB
  • PDF/home-sweet-home.pdf 473.5 kB
  • PDF/homecoming-by-kanye-west.pdf 150.4 kB
  • PDF/homeless.pdf 248.7 kB
  • PDF/homeworkbt.pdf 1.2 MB
  • PDF/homographs.pdf 186.6 kB
  • PDF/homonyms-konacna-verzija-2003.pdf 157.1 kB
  • PDF/homonyms.pdf 234.4 kB
  • PDF/homophones-2003.pdf 53.5 kB
  • PDF/hot-and-cold.pdf 190.1 kB
  • PDF/hot-cold.pdf 181.8 kB
  • PDF/hotel-california.pdf 48.0 kB
  • PDF/hotel-review.pdf 186.3 kB
  • PDF/hotel-transylvania-work-sheet.pdf 251.0 kB
  • PDF/hotel-vocabulary-bingo.pdf 92.0 kB
  • PDF/House Objects.pdf 216.5 kB
  • PDF/house words.pdf 212.4 kB
  • PDF/house-and-lost-series-worksheet.pdf 241.6 kB
  • PDF/house-battleship.pdf 133.6 kB
  • PDF/house-hold-board.pdf 652.3 kB
  • PDF/house-mini.pdf 858.4 kB
  • PDF/house.pdf 189.3 kB
  • PDF/house_red.pdf 331.5 kB
  • PDF/household-chores-simple-present-tense.pdf 49.0 kB
  • PDF/household-chores-simple-reading.pdf 283.2 kB
  • PDF/household-chores.pdf 894.0 kB
  • PDF/household-chores1.pdf 504.3 kB
  • PDF/household-jobs-crossword.pdf 46.0 kB
  • PDF/houses-of-lords_worksheet.pdf 389.8 kB
  • PDF/How are you feeling today.pdf 219.8 kB
  • PDF/how-are-you-feeling.pdf 1.7 MB
  • PDF/how-coyote-made-the-winter.pdf 1.0 MB
  • PDF/how-did-you-spend-this-summer.pdf 33.3 kB
  • PDF/how-fashionable-are-you.pdf 106.7 kB
  • PDF/how-i-met-your-mother-1.pdf 31.0 kB
  • PDF/how-it.pdf 104.8 kB
  • PDF/how-its-made-bubble-gum.pdf 381.5 kB
  • PDF/how-long-worksheet.pdf 68.9 kB
  • PDF/how-long.pdf 71.2 kB
  • PDF/how-long_001.pdf 281.8 kB
  • PDF/how-many-words-can-you-write-with-these-letters.pdf 184.7 kB
  • PDF/how-much-geography-do-you-know.pdf 223.0 kB
  • PDF/how-often-cards.pdf 800.5 kB
  • PDF/how-often-questions.pdf 21.1 kB
  • PDF/how-old-are.pdf 333.3 kB
  • PDF/how-to-be-a-gentleman.pdf 47.9 kB
  • PDF/how-to-cook.pdf 218.0 kB
  • PDF/how-to-kill-someone-233l232ve.pdf 124.6 kB
  • PDF/how-to-reduce-christmas-waste.pdf 169.5 kB
  • PDF/how-to-save-a-life.pdf 303.9 kB
  • PDF/how-to-write-a-summary.pdf 42.7 kB
  • PDF/how-to-write-emails-in-english.pdf 399.0 kB
  • PDF/howmuch.pdf 1.2 MB
  • PDF/human-bingo-how-i-spent-my-summer.pdf 28.9 kB
  • PDF/human-bingo.pdf 22.7 kB
  • PDF/human-body-test.pdf 56.5 kB
  • PDF/hunger-games-video-session.pdf 393.7 kB
  • PDF/hurricane-sandy-video-lesson.pdf 21.0 kB
  • PDF/hurts.pdf 190.8 kB
  • PDF/husband_wife_phrasal_verb_roleplay.pdf 18.0 kB
  • PDF/hw-cxd-gr-1-1.pdf 587.7 kB
  • PDF/hwy_pre_webtextsu12-14.pdf 86.0 kB
  • PDF/hypothetical-situations-practice.pdf 608.6 kB
  • PDF/hyy_apr2011_calendar.pdf 331.3 kB
  • PDF/hyy_aug2010_calendar.pdf 148.8 kB
  • PDF/hyy_aug2011_calendar.pdf 131.5 kB
  • PDF/hyy_christmas_colorpages.pdf 230.2 kB
  • PDF/hyy_coloring_book.pdf 1.5 MB
  • PDF/hyy_feb2011_calendar.pdf 2.2 MB
  • PDF/hyy_headphonebling.pdf 195.3 kB
  • PDF/hyy_jan2011_calendar.pdf 243.9 kB
  • PDF/hyy_jul2011_calendar.pdf 109.5 kB
  • PDF/hyy_july2010_calendar.pdf 149.7 kB
  • PDF/hyy_jun2011_calendar.pdf 282.5 kB
  • PDF/hyy_june2010_calendar.pdf 165.4 kB
  • PDF/hyy_mar2011_calendar.pdf 184.5 kB
  • PDF/hyy_may2011_calendar.pdf 106.0 kB
  • PDF/hyy_nov2010_calendar.pdf 209.6 kB
  • PDF/hyy_oct2010_calendar.pdf 187.0 kB
  • PDF/hyy_office_notes.pdf 2.3 MB
  • PDF/hyy_office_notes2.pdf 142.3 kB
  • PDF/hyy_office_notes2_001.pdf 142.3 kB
  • PDF/hyy_sept2010_calendar.pdf 375.9 kB
  • PDF/hyy_sept2011_calendar.pdf 1.5 MB
  • PDF/I know what you did.pdf 216.0 kB
  • PDF/I love the way you lie Word Seach.pdf 218.0 kB
  • PDF/i-am-lazy-and-i-know-it.pdf 58.4 kB
  • PDF/i-believe-in-father-christmas.pdf 124.3 kB
  • PDF/i-can-count-to-10-numerals.pdf 332.1 kB
  • PDF/i-can_i-cant.pdf 399.9 kB
  • PDF/i-have-a-spelling-checker.pdf 125.9 kB
  • PDF/i-have-done-or-i-did.pdf 388.9 kB
  • PDF/i-have-got-by-kik.pdf 266.2 kB
  • PDF/i-have.pdf 302.5 kB
  • PDF/i-live-inon.pdf 186.5 kB
  • PDF/i-say-a-little-prayer-for-you_present-simple.pdf 120.5 kB
  • PDF/i-see-the-light.pdf 37.7 kB
  • PDF/i-still-havent-found-u2.pdf 137.3 kB
  • PDF/i-want-a-hyppo-for-christmas.pdf 129.6 kB
  • PDF/i-will-love-again-puzzle-full-activity.pdf 472.3 kB
  • PDF/i-will-survive.pdf 83.6 kB
  • PDF/i-will-survive_001.pdf 383.4 kB
  • PDF/i_dont_wanna_miss_a_thing.pdf 396.2 kB
  • PDF/ice-age-4-worksheet.pdf 182.1 kB
  • PDF/icebreaker-star.pdf 74.0 kB
  • PDF/icebreakers.pdf 116.1 kB
  • PDF/icebreakers_001.pdf 55.6 kB
  • PDF/icecream.pdf 205.0 kB
  • PDF/ict-shakespeare.pdf 48.0 kB
  • PDF/ideas-for-parent-teacher-conferences.pdf 417.8 kB
  • PDF/identity.pdf 26.4 kB
  • PDF/idioms-about-love.pdf 341.1 kB
  • PDF/idioms-pic.pdf 553.1 kB
  • PDF/idioms-with-parts-of-the-body.pdf 487.2 kB
  • PDF/idioms.pdf 380.9 kB
  • PDF/idioms1.pdf 145.5 kB
  • PDF/idioms_001.pdf 322.7 kB
  • PDF/idioms_002.pdf 487.6 kB
  • PDF/idioms_weather.pdf 96.9 kB
  • PDF/idomes-about-good-behaviour-and-politeness.pdf 65.8 kB
  • PDF/ielts-vocabulary-handout.pdf 27.9 kB
  • PDF/if-clauses-mix.pdf 68.9 kB
  • PDF/if-clauses-rephrasing.pdf 33.1 kB
  • PDF/if-clauses.pdf 478.3 kB
  • PDF/if-environment.pdf 485.9 kB
  • PDF/if-i-controlled-the-internet.pdf 82.8 kB
  • PDF/if-i-had-a-million-dollars.pdf 20.9 kB
  • PDF/if-i-were-a-boy_if-clauses.pdf 281.7 kB
  • PDF/if-only_i-wish_potpourri.pdf 57.8 kB
  • PDF/if-you-are-going-to-san-francisco.pdf 388.9 kB
  • PDF/if-you-were-sailboat-katie-melua.pdf 50.8 kB
  • PDF/ifclauses.pdf 116.1 kB
  • PDF/ifclauses_001.pdf 116.1 kB
  • PDF/iggie.pdf 231.9 kB
  • PDF/igk-gyakorls.pdf 485.3 kB
  • PDF/iguana-body-parts.pdf 92.6 kB
  • PDF/iguana-toucan-opisy.pdf 54.4 kB
  • PDF/ill-be-gone.pdf 57.4 kB
  • PDF/ill-do-it.pdf 829.6 kB
  • PDF/illnesses.pdf 149.7 kB
  • PDF/illnesses_001.pdf 231.9 kB
  • PDF/im-a-believer.pdf 231.3 kB
  • PDF/im-getting-ready-by-michael-kiwanuka-lyrics.pdf 267.6 kB
  • PDF/im-not-calling-you-a-liar.pdf 151.4 kB
  • PDF/im-wide-awake-katy-perry.pdf 75.4 kB
  • PDF/im-yours.pdf 198.5 kB
  • PDF/imagine-by-john-lenno1.pdf 129.5 kB
  • PDF/imagine.pdf 77.3 kB
  • PDF/imperative-game.pdf 298.0 kB
  • PDF/imperative.pdf 1.0 MB
  • PDF/imperative_001.pdf 180.3 kB
  • PDF/imperatives-with-aches-and-pains.pdf 303.1 kB
  • PDF/impersonal-report-structures.pdf 214.3 kB
  • PDF/important-numbers.pdf 104.2 kB
  • PDF/impression.pdf 18.7 kB
  • PDF/impromptu-speech-activity.pdf 51.2 kB
  • PDF/IN THE CITY.pdf 212.7 kB
  • PDF/in-a-restaurant_complaint.pdf 2.1 MB
  • PDF/in-my-nice-big-flat2.pdf 66.8 kB
  • PDF/in-on-under.pdf 21.5 kB
  • PDF/in-other-words-passive-voice.pdf 38.4 kB
  • PDF/in-other-words.pdf 60.7 kB
  • PDF/in-the-kitchen-deco.pdf 216.1 kB
  • PDF/in-the-kitchen.pdf 192.3 kB
  • PDF/in-the-office.pdf 644.0 kB
  • PDF/in-the-restaurant.pdf 207.8 kB
  • PDF/in-the-town.pdf 1.7 MB
  • PDF/in-treatment-season-1-episode-5.pdf 69.8 kB
  • PDF/in-your-hands2.pdf 32.3 kB
  • PDF/indefinte-pronouns-2012.pdf 130.1 kB
  • PDF/indepday.pdf 563.0 kB
  • PDF/independence-day-liberty-book.pdf 45.6 kB
  • PDF/independence-day-old-glory.pdf 209.5 kB
  • PDF/independence-day-partiotic.pdf 63.7 kB
  • PDF/independence-day-reading.pdf 40.8 kB
  • PDF/independence-day-uncle-sam-standup.pdf 49.2 kB
  • PDF/independence-day-what-liberty-means.pdf 32.6 kB
  • PDF/indian_outlaw_lyrics.pdf 30.9 kB
  • PDF/indirect_questions_for_busyteacher.pdf 230.5 kB
  • PDF/inf-or-ing-key.pdf 1.9 MB
  • PDF/infinitive-of-purpose-for-it.pdf 78.0 kB
  • PDF/infinitive-of-purpose.pdf 102.2 kB
  • PDF/infinitive-or.pdf 112.6 kB
  • PDF/infinitive.pdf 212.6 kB
  • PDF/ingls-8-adverbios-de-frecuencia.pdf 689.9 kB
  • PDF/inju.pdf 55.3 kB
  • PDF/inquiry-cycle.pdf 3.4 MB
  • PDF/insect.pdf 187.8 kB
  • PDF/insects.pdf 485.5 kB
  • PDF/inside_out_int_a_true_crime_story.pdf 191.5 kB
  • PDF/inside_out_int_a_true_crime_story_001.pdf 191.5 kB
  • PDF/inside_out_int_blockbuster.pdf 117.2 kB
  • PDF/inside_out_int_blockbuster_001.pdf 117.2 kB
  • PDF/inside_out_int_by_the_year_10000.pdf 112.6 kB
  • PDF/inside_out_int_by_the_year_10000_001.pdf 112.6 kB
  • PDF/inside_out_int_clueless.pdf 116.0 kB
  • PDF/inside_out_int_clueless_001.pdf 116.0 kB
  • PDF/inside_out_int_crosswords.pdf 92.4 kB
  • PDF/inside_out_int_crosswords_001.pdf 92.4 kB
  • PDF/inside_out_int_detectives.pdf 142.0 kB
  • PDF/inside_out_int_detectives_001.pdf 142.0 kB
  • PDF/inside_out_int_dominoes.pdf 146.4 kB
  • PDF/inside_out_int_dominoes_001.pdf 146.4 kB
  • PDF/inside_out_int_dress_to_kill.pdf 123.4 kB
  • PDF/inside_out_int_dress_to_kill_001.pdf 123.4 kB
  • PDF/inside_out_int_feng_shui.pdf 111.7 kB
  • PDF/inside_out_int_feng_shui_001.pdf 111.7 kB
  • PDF/inside_out_int_fiesta.pdf 185.7 kB
  • PDF/inside_out_int_fiesta_001.pdf 185.7 kB
  • PDF/inside_out_int_first_impressions.pdf 81.9 kB
  • PDF/inside_out_int_first_impressions_001.pdf 81.9 kB
  • PDF/inside_out_int_food_sleep_and_shelter.pdf 104.6 kB
  • PDF/inside_out_int_food_sleep_and_shelter_001.pdf 104.6 kB
  • PDF/inside_out_int_globetrotters.pdf 111.3 kB
  • PDF/inside_out_int_globetrotters_001.pdf 111.3 kB
  • PDF/inside_out_int_guess_the_sport.pdf 142.6 kB
  • PDF/inside_out_int_guess_the_sport_001.pdf 142.6 kB
  • PDF/inside_out_int_hi_how_are_you.pdf 132.5 kB
  • PDF/inside_out_int_hi_how_are_you_001.pdf 132.5 kB
  • PDF/inside_out_int_how_well_do_you_know_your_classmates.pdf 105.8 kB
  • PDF/inside_out_int_how_well_do_you_know_your_classmates_001.pdf 105.8 kB
  • PDF/inside_out_int_how_well_organized_are_you.pdf 144.2 kB
  • PDF/inside_out_int_how_well_organized_are_you_001.pdf 144.2 kB
  • PDF/inside_out_int_i_wish.pdf 78.7 kB
  • PDF/inside_out_int_i_wish_001.pdf 78.7 kB
  • PDF/inside_out_int_if.pdf 87.7 kB
  • PDF/inside_out_int_if_001.pdf 87.7 kB
  • PDF/inside_out_int_intepreter.pdf 132.0 kB
  • PDF/inside_out_int_intepreter_001.pdf 132.0 kB
  • PDF/inside_out_int_irregular_battleships.pdf 135.4 kB
  • PDF/inside_out_int_irregular_battleships_001.pdf 135.4 kB
  • PDF/inside_out_int_just_a_minute.pdf 123.6 kB
  • PDF/inside_out_int_just_a_minute_001.pdf 123.6 kB
  • PDF/inside_out_int_knowitalls.pdf 69.6 kB
  • PDF/inside_out_int_knowitalls_001.pdf 69.6 kB
  • PDF/inside_out_int_love_is.pdf 105.4 kB
  • PDF/inside_out_int_love_is_001.pdf 105.4 kB
  • PDF/inside_out_int_make__do.pdf 103.4 kB
  • PDF/inside_out_int_make__do_001.pdf 103.4 kB
  • PDF/inside_out_int_making_news.pdf 156.8 kB
  • PDF/inside_out_int_making_news_001.pdf 156.8 kB
  • PDF/inside_out_int_parents_day.pdf 130.1 kB
  • PDF/inside_out_int_parents_day_001.pdf 130.1 kB
  • PDF/inside_out_int_postcards.pdf 103.6 kB
  • PDF/inside_out_int_postcards_001.pdf 103.6 kB
  • PDF/inside_out_int_questions.pdf 121.3 kB
  • PDF/inside_out_int_questions_001.pdf 121.3 kB
  • PDF/inside_out_int_reasons_to_be_famous.pdf 133.1 kB
  • PDF/inside_out_int_reasons_to_be_famous_001.pdf 133.1 kB
  • PDF/inside_out_int_the_dinner_party.pdf 113.3 kB
  • PDF/inside_out_int_the_dinner_party_001.pdf 113.3 kB
  • PDF/inside_out_int_the_stress_test.pdf 125.7 kB
  • PDF/inside_out_int_the_stress_test_001.pdf 125.7 kB
  • PDF/inside_out_int_then_and_now.pdf 89.4 kB
  • PDF/inside_out_int_then_and_now_001.pdf 89.4 kB
  • PDF/inside_out_int_true_or_false.pdf 95.6 kB
  • PDF/inside_out_int_true_or_false_001.pdf 95.6 kB
  • PDF/inside_out_int_useless_information.pdf 127.3 kB
  • PDF/inside_out_int_useless_information_001.pdf 127.3 kB
  • PDF/inside_out_int_when_i_was_at_school.pdf 116.8 kB
  • PDF/inside_out_int_when_i_was_at_school_001.pdf 116.8 kB
  • PDF/inside_out_int_you_in_pictures.pdf 122.1 kB
  • PDF/inside_out_int_you_in_pictures_001.pdf 122.1 kB
  • PDF/insideout.pdf 115.4 kB
  • PDF/insideout_001.pdf 128.6 kB
  • PDF/insideout_002.pdf 109.3 kB
  • PDF/insideout_003.pdf 290.2 kB
  • PDF/insideout_004.pdf 290.2 kB
  • PDF/insideout_005.pdf 100.7 kB
  • PDF/insideout_006.pdf 188.3 kB
  • PDF/insideout_007.pdf 115.1 kB
  • PDF/insideout_008.pdf 140.8 kB
  • PDF/insideout_009.pdf 153.7 kB
  • PDF/insideout_010.pdf 132.7 kB
  • PDF/insideout_011.pdf 108.7 kB
  • PDF/insideout_012.pdf 216.5 kB
  • PDF/insideout_013.pdf 138.2 kB
  • PDF/insideout_014.pdf 121.2 kB
  • PDF/insideout_015.pdf 134.8 kB
  • PDF/insideout_016.pdf 113.7 kB
  • PDF/insideout_017.pdf 224.7 kB
  • PDF/insideout_018.pdf 108.7 kB
  • PDF/insideout_019.pdf 139.6 kB
  • PDF/insideout_020.pdf 140.8 kB
  • PDF/insideout_021.pdf 171.6 kB
  • PDF/insideout_022.pdf 153.8 kB
  • PDF/insideout_023.pdf 94.5 kB
  • PDF/insideout_024.pdf 122.4 kB
  • PDF/insideout_025.pdf 144.7 kB
  • PDF/insideout_026.pdf 139.8 kB
  • PDF/insideout_027.pdf 143.4 kB
  • PDF/insideout_028.pdf 130.1 kB
  • PDF/insideout_029.pdf 112.3 kB
  • PDF/insideout_030.pdf 128.8 kB
  • PDF/insideout_031.pdf 137.8 kB
  • PDF/insideout_032.pdf 123.7 kB
  • PDF/insideout_033.pdf 101.0 kB
  • PDF/insideout_034.pdf 121.0 kB
  • PDF/insideout_035.pdf 111.5 kB
  • PDF/insideout_036.pdf 115.4 kB
  • PDF/insideout_037.pdf 128.6 kB
  • PDF/insideout_038.pdf 109.3 kB
  • PDF/insideout_039.pdf 290.2 kB
  • PDF/insideout_040.pdf 290.2 kB
  • PDF/insideout_041.pdf 100.7 kB
  • PDF/insideout_042.pdf 188.3 kB
  • PDF/insideout_043.pdf 115.1 kB
  • PDF/insideout_044.pdf 140.8 kB
  • PDF/insideout_045.pdf 153.7 kB
  • PDF/insideout_046.pdf 132.7 kB
  • PDF/insideout_047.pdf 108.7 kB
  • PDF/insideout_048.pdf 216.5 kB
  • PDF/insideout_049.pdf 138.2 kB
  • PDF/insideout_050.pdf 121.2 kB
  • PDF/insideout_051.pdf 134.8 kB
  • PDF/insideout_052.pdf 113.7 kB
  • PDF/insideout_053.pdf 224.7 kB
  • PDF/insideout_054.pdf 108.7 kB
  • PDF/insideout_055.pdf 139.6 kB
  • PDF/insideout_056.pdf 140.8 kB
  • PDF/insideout_057.pdf 171.6 kB
  • PDF/insideout_058.pdf 153.8 kB
  • PDF/insideout_059.pdf 94.5 kB
  • PDF/insideout_060.pdf 122.4 kB
  • PDF/insideout_061.pdf 144.7 kB
  • PDF/insideout_062.pdf 139.8 kB
  • PDF/insideout_063.pdf 143.4 kB
  • PDF/insideout_064.pdf 130.1 kB
  • PDF/insideout_065.pdf 112.3 kB
  • PDF/insideout_066.pdf 128.8 kB
  • PDF/insideout_067.pdf 137.8 kB
  • PDF/insideout_068.pdf 123.7 kB
  • PDF/insideout_069.pdf 101.0 kB
  • PDF/insideout_070.pdf 121.0 kB
  • PDF/insideout_071.pdf 111.5 kB
  • PDF/inspirational-stories.pdf 1.8 MB
  • PDF/instant_lessons_elementaryadverbs.pdf 89.0 kB
  • PDF/instant_lessons_elementaryadverbs_001.pdf 89.0 kB
  • PDF/instant_lessons_elementaryadvicefromanna.pdf 108.2 kB
  • PDF/instant_lessons_elementaryadvicefromanna_001.pdf 108.2 kB
  • PDF/instant_lessons_elementaryanenglishweekend.pdf 131.7 kB
  • PDF/instant_lessons_elementaryanenglishweekend_001.pdf 131.7 kB
  • PDF/instant_lessons_elementaryanewlife.pdf 269.4 kB
  • PDF/instant_lessons_elementaryanewlife_001.pdf 269.4 kB
  • PDF/instant_lessons_elementaryclothes.pdf 240.4 kB
  • PDF/instant_lessons_elementaryclothes_001.pdf 240.4 kB
  • PDF/instant_lessons_elementarycolours.pdf 99.3 kB
  • PDF/instant_lessons_elementarycolours_001.pdf 99.3 kB
  • PDF/instant_lessons_elementaryconsequesnces.pdf 89.7 kB
  • PDF/instant_lessons_elementaryconsequesnces_001.pdf 89.7 kB
  • PDF/instant_lessons_elementarycountriesnationalities.pdf 145.5 kB
  • PDF/instant_lessons_elementarycountriesnationalities_001.pdf 145.5 kB
  • PDF/instant_lessons_elementarydemonstrativespossessives.pdf 241.8 kB
  • PDF/instant_lessons_elementarydemonstrativespossessives_001.pdf 241.8 kB
  • PDF/instant_lessons_elementaryfood.pdf 153.6 kB
  • PDF/instant_lessons_elementaryfood_001.pdf 153.6 kB
  • PDF/instant_lessons_elementaryfoodforthought.pdf 125.9 kB
  • PDF/instant_lessons_elementaryfoodforthought_001.pdf 125.9 kB
  • PDF/instant_lessons_elementaryfootball.pdf 169.4 kB
  • PDF/instant_lessons_elementaryfootball_001.pdf 169.4 kB
  • PDF/instant_lessons_elementaryfoureasysteps.pdf 122.2 kB
  • PDF/instant_lessons_elementaryfoureasysteps_001.pdf 122.2 kB
  • PDF/instant_lessons_elementaryfrequencyadverbs.pdf 212.3 kB
  • PDF/instant_lessons_elementaryfrequencyadverbs_001.pdf 212.3 kB
  • PDF/instant_lessons_elementaryhealth.pdf 245.2 kB
  • PDF/instant_lessons_elementaryhealth_001.pdf 245.2 kB
  • PDF/instant_lessons_elementaryhelp.pdf 224.1 kB
  • PDF/instant_lessons_elementaryhelp_001.pdf 224.1 kB
  • PDF/instant_lessons_elementaryholiday.pdf 259.2 kB
  • PDF/instant_lessons_elementaryholiday_001.pdf 259.2 kB
  • PDF/instant_lessons_elementaryhowdoyousleep.pdf 144.5 kB
  • PDF/instant_lessons_elementaryhowdoyousleep_001.pdf 144.5 kB
  • PDF/instant_lessons_elementaryididntdoit.pdf 262.8 kB
  • PDF/instant_lessons_elementaryididntdoit_001.pdf 262.8 kB
  • PDF/instant_lessons_elementarymyidealpenfriend.pdf 149.4 kB
  • PDF/instant_lessons_elementarymyidealpenfriend_001.pdf 149.4 kB
  • PDF/instant_lessons_elementarypastsvspastcont.pdf 255.3 kB
  • PDF/instant_lessons_elementarypastsvspastcont_001.pdf 255.3 kB
  • PDF/instant_lessons_elementaryphotographs.pdf 466.0 kB
  • PDF/instant_lessons_elementaryphotographs_001.pdf 466.0 kB
  • PDF/instant_lessons_elementarypostcards.pdf 240.1 kB
  • PDF/instant_lessons_elementarypostcards_001.pdf 240.1 kB
  • PDF/instant_lessons_elementaryprepositionsofplace.pdf 391.1 kB
  • PDF/instant_lessons_elementaryprepositionsofplace_001.pdf 391.1 kB
  • PDF/instant_lessons_elementaryprepositionsoftime.pdf 217.5 kB
  • PDF/instant_lessons_elementaryprepositionsoftime_001.pdf 217.5 kB
  • PDF/instant_lessons_elementarypresentsimple.pdf 221.5 kB
  • PDF/instant_lessons_elementarypresentsimple_001.pdf 221.5 kB
  • PDF/instant_lessons_elementarypressimpleinterrogneg.pdf 216.2 kB
  • PDF/instant_lessons_elementarypressimpleinterrogneg_001.pdf 216.2 kB
  • PDF/instant_lessons_int_a_warm_welcome.pdf 248.7 kB
  • PDF/instant_lessons_int_a_warm_welcome_001.pdf 248.7 kB
  • PDF/instant_lessons_int_are_you_green.pdf 232.7 kB
  • PDF/instant_lessons_int_are_you_green_001.pdf 232.7 kB
  • PDF/instant_lessons_int_comparisons.pdf 333.5 kB
  • PDF/instant_lessons_int_comparisons_001.pdf 333.5 kB
  • PDF/instant_lessons_int_conditional1.pdf 352.3 kB
  • PDF/instant_lessons_int_conditional1_001.pdf 352.3 kB
  • PDF/instant_lessons_int_conditional2.pdf 328.6 kB
  • PDF/instant_lessons_int_conditional2_001.pdf 328.6 kB
  • PDF/instant_lessons_int_create_a_word_puzzle.pdf 147.5 kB
  • PDF/instant_lessons_int_create_a_word_puzzle_001.pdf 147.5 kB
  • PDF/instant_lessons_int_do_you_believe_in_ghosts.pdf 413.1 kB
  • PDF/instant_lessons_int_do_you_believe_in_ghosts_001.pdf 413.1 kB
  • PDF/instant_lessons_int_four_portraits.pdf 447.8 kB
  • PDF/instant_lessons_int_four_portraits_001.pdf 447.8 kB
  • PDF/instant_lessons_int_giving_definitions.pdf 488.8 kB
  • PDF/instant_lessons_int_giving_definitions_001.pdf 488.8 kB
  • PDF/instant_lessons_int_homophones.pdf 342.1 kB
  • PDF/instant_lessons_int_homophones_001.pdf 342.1 kB
  • PDF/instant_lessons_int_how_are_you_how_do_you_feel.pdf 228.5 kB
  • PDF/instant_lessons_int_how_are_you_how_do_you_feel_001.pdf 228.5 kB
  • PDF/instant_lessons_int_in_the_news_this_week.pdf 258.8 kB
  • PDF/instant_lessons_int_in_the_news_this_week_001.pdf 258.8 kB
  • PDF/instant_lessons_int_looking_after_yourself.pdf 240.4 kB
  • PDF/instant_lessons_int_looking_after_yourself_001.pdf 240.4 kB
  • PDF/instant_lessons_int_lots_of_letters.pdf 197.1 kB
  • PDF/instant_lessons_int_lots_of_letters_001.pdf 197.1 kB
  • PDF/instant_lessons_int_my_cv.pdf 215.0 kB
  • PDF/instant_lessons_int_my_cv_001.pdf 215.0 kB
  • PDF/instant_lessons_int_pairs_of_words_that_are_often_confused.pdf 441.6 kB
  • PDF/instant_lessons_int_pairs_of_words_that_are_often_confused_001.pdf 441.6 kB
  • PDF/instant_lessons_int_past_simple_v_present_perfect.pdf 365.2 kB
  • PDF/instant_lessons_int_past_simple_v_present_perfect_001.pdf 365.2 kB
  • PDF/instant_lessons_int_personality_quiz.pdf 373.4 kB
  • PDF/instant_lessons_int_personality_quiz_001.pdf 373.4 kB
  • PDF/instant_lessons_int_phrasal_verbs_with_out.pdf 356.1 kB
  • PDF/instant_lessons_int_phrasal_verbs_with_out_001.pdf 356.1 kB
  • PDF/instant_lessons_int_phrasal_verbs_with_up.pdf 224.0 kB
  • PDF/instant_lessons_int_phrasal_verbs_with_up_001.pdf 224.0 kB
  • PDF/instant_lessons_int_prefixes.pdf 293.9 kB
  • PDF/instant_lessons_int_prefixes_001.pdf 293.9 kB
  • PDF/instant_lessons_int_san_francisco.pdf 603.4 kB
  • PDF/instant_lessons_int_san_francisco_001.pdf 603.4 kB
  • PDF/instant_lessons_int_selfawareness.pdf 461.1 kB
  • PDF/instant_lessons_int_selfawareness_001.pdf 461.1 kB
  • PDF/instant_lessons_int_short_answers_with_so_or_neither.pdf 354.7 kB
  • PDF/instant_lessons_int_short_answers_with_so_or_neither_001.pdf 354.7 kB
  • PDF/instant_lessons_int_strange_facts_and_quotations.pdf 378.5 kB
  • PDF/instant_lessons_int_strange_facts_and_quotations_001.pdf 378.5 kB
  • PDF/instant_lessons_int_telling_stories.pdf 152.4 kB
  • PDF/instant_lessons_int_telling_stories_001.pdf 152.4 kB
  • PDF/instant_lessons_int_the_article.pdf 338.9 kB
  • PDF/instant_lessons_int_the_article_001.pdf 338.9 kB
  • PDF/instant_lessons_int_the_passive.pdf 438.2 kB
  • PDF/instant_lessons_int_the_passive_001.pdf 438.2 kB
  • PDF/instant_lessons_int_two_poems.pdf 320.3 kB
  • PDF/instant_lessons_int_two_poems_001.pdf 320.3 kB
  • PDF/instant_lessons_int_twominute_stories.pdf 385.9 kB
  • PDF/instant_lessons_int_twominute_stories_001.pdf 385.9 kB
  • PDF/instant_lessons_int_types_of_people.pdf 314.1 kB
  • PDF/instant_lessons_int_types_of_people_001.pdf 314.1 kB
  • PDF/instant_lessons_int_where_to_go_and_what_to_see.pdf 296.0 kB
  • PDF/instant_lessons_int_where_to_go_and_what_to_see_001.pdf 296.0 kB
  • PDF/instant_lessons_int_words_and_phrases_with_make_and_do.pdf 370.6 kB
  • PDF/instant_lessons_int_words_and_phrases_with_make_and_do_001.pdf 370.6 kB
  • PDF/instant_lessons_int_writing_home.pdf 206.6 kB
  • PDF/instant_lessons_int_writing_home_001.pdf 206.6 kB
  • PDF/instrument.pdf 232.7 kB
  • PDF/int-2-day-1.pdf 101.8 kB
  • PDF/int-2-unit-6.pdf 31.4 kB
  • PDF/int-2-unit-6_001.pdf 77.0 kB
  • PDF/int01.pdf 22.3 kB
  • PDF/int01_001.pdf 22.3 kB
  • PDF/int02.pdf 20.4 kB
  • PDF/int02_001.pdf 20.4 kB
  • PDF/int03.pdf 27.5 kB
  • PDF/int03_001.pdf 27.5 kB
  • PDF/int04.pdf 26.6 kB
  • PDF/int04_001.pdf 26.6 kB
  • PDF/int05.pdf 23.2 kB
  • PDF/int05_001.pdf 23.2 kB
  • PDF/int06_memory.pdf 171.9 kB
  • PDF/int06_memory_001.pdf 171.9 kB
  • PDF/int07_socialising.pdf 136.0 kB
  • PDF/int07_socialising_001.pdf 136.0 kB
  • PDF/int08_situational.pdf 151.6 kB
  • PDF/int08_situational_001.pdf 151.6 kB
  • PDF/int09_probability.pdf 165.7 kB
  • PDF/int09_probability_001.pdf 165.7 kB
  • PDF/int10_saytell.pdf 151.8 kB
  • PDF/int10_saytell_001.pdf 151.8 kB
  • PDF/int2-have-you-ever.pdf 63.1 kB
  • PDF/int_15_worksheetcomparisons.pdf 47.4 kB
  • PDF/int_15_worksheetcomparisons_001.pdf 47.4 kB
  • PDF/interesting-cultural-facts-echo-questions.pdf 2.0 MB
  • PDF/interesting-facts-about-the-usa.pdf 193.9 kB
  • PDF/interm-practice-work.pdf 312.2 kB
  • PDF/intermed-love-problems.pdf 138.8 kB
  • PDF/intermediate-advanced-oral-presentation-rubric.pdf 76.2 kB
  • PDF/intermediate-conversation-business-resume.pdf 137.4 kB
  • PDF/international-express-supplementary-activities.pdf 821.9 kB
  • PDF/international-food.pdf 378.0 kB
  • PDF/interviewquest.pdf 42.5 kB
  • PDF/into-the-dark.pdf 32.6 kB
  • PDF/intro-b-unit-14-simple-past-adele.pdf 352.5 kB
  • PDF/intro-b-unit-16-object-pronouns.pdf 450.5 kB
  • PDF/intro-b-unit-16-prepositions.pdf 660.0 kB
  • PDF/intro-to-eng-conditionals.pdf 440.1 kB
  • PDF/introducing-friends.pdf 85.4 kB
  • PDF/introducing-sports-play_do_go.pdf 1.4 MB
  • PDF/introducing.pdf 26.6 kB
  • PDF/introductions-lesson.pdf 578.3 kB
  • PDF/inventions-past-forms-expressing-opinion.pdf 760.7 kB
  • PDF/inventions.pdf 45.1 kB
  • PDF/inventions_001.pdf 158.2 kB
  • PDF/inversions.pdf 279.5 kB
  • PDF/invictusq.pdf 290.2 kB
  • PDF/io288saprilfoolsday.pdf 43.5 kB
  • PDF/io288saprilfoolsday_001.pdf 43.5 kB
  • PDF/ipa-flashcards.pdf 70.9 kB
  • PDF/iphone-4s.pdf 40.2 kB
  • PDF/ir-verbs-rhymes.pdf 1.2 MB
  • PDF/ir11sep.pdf 559.3 kB
  • PDF/irelands-unusual-places-to-stay.pdf 192.0 kB
  • PDF/iron-lady-opinion-article.pdf 91.9 kB
  • PDF/irr-verbs-bookmark.pdf 98.7 kB
  • PDF/irreg-verbs-simple-past.pdf 398.6 kB
  • PDF/irreg.pdf 1.2 MB
  • PDF/irregualr-verbs.pdf 24.4 kB
  • PDF/Irregular Verbs Wordsearch.pdf 212.8 kB
  • PDF/Irregular Verbs.pdf 218.1 kB
  • PDF/Irregular Verbs_001.pdf 220.8 kB
  • PDF/irregular-bookmark.pdf 140.5 kB
  • PDF/irregular-card-game.pdf 918.1 kB
  • PDF/irregular-cards-2011.pdf 488.0 kB
  • PDF/irregular-game-2011.pdf 677.2 kB
  • PDF/irregular-past-tense-bingo-1.pdf 490.6 kB
  • PDF/irregular-past-tense-bingo-2.pdf 482.8 kB
  • PDF/irregular-past-tense-verbs.pdf 105.6 kB
  • PDF/irregular-plural.pdf 29.0 kB
  • PDF/irregular-verbs-basic-verbs-with-pronunciation.pdf 3.4 MB
  • PDF/irregular-verbs-cloud.pdf 721.5 kB
  • PDF/irregular-verbs-divided-in-groups.pdf 622.0 kB
  • PDF/irregular-verbs-elementary.pdf 734.8 kB
  • PDF/irregular-verbs-exercises.pdf 48.2 kB
  • PDF/irregular-verbs-in-groups_exercise.pdf 51.7 kB
  • PDF/irregular-verbs-infinite.pdf 63.3 kB
  • PDF/irregular-verbs-mnemonic-rhyming-groups-2012.pdf 131.2 kB
  • PDF/irregular-verbs-simple-past.pdf 64.4 kB
  • PDF/irregular-verbs-test.pdf 28.6 kB
  • PDF/irregular-verbs_word-search_created-by-silvina.pdf 219.8 kB
  • PDF/irregular.pdf 88.7 kB
  • PDF/irregular01.pdf 37.2 kB
  • PDF/irregular01_001.pdf 37.2 kB
  • PDF/irregular_verbs.pdf 293.3 kB
  • PDF/irrg-v.pdf 120.2 kB
  • PDF/is-this-the-most-dangerous-restaurant-in-the-world.pdf 488.4 kB
  • PDF/is-this-yours.pdf 137.7 kB
  • PDF/issues.pdf 51.8 kB
  • PDF/ithaka.pdf 44.4 kB
  • PDF/Its Showtime Wordsearch .pdf 220.4 kB
  • PDF/its-carnival-time.pdf 742.0 kB
  • PDF/its-cloudy.pdf 15.2 kB
  • PDF/its-cold-in-january.pdf 105.1 kB
  • PDF/its-rainy.pdf 31.3 kB
  • PDF/its-sunny.pdf 27.7 kB
  • PDF/ive-got-my-own-room.pdf 131.8 kB
  • PDF/ive-seen-it-all.pdf 84.2 kB
  • PDF/ive_got.pdf 662.3 kB
  • PDF/iz-over-the-rainbow.pdf 377.0 kB
  • PDF/jane-austen-2.pdf 4.7 MB
  • PDF/january-calendar-1.pdf 4.7 MB
  • PDF/january-holidays.pdf 356.6 kB
  • PDF/january.pdf 286.3 kB
  • PDF/jasonmraz-lifeiswonderful-2.pdf 53.4 kB
  • PDF/jeopardy.pdf 242.1 kB
  • PDF/jeremy.pdf 108.8 kB
  • PDF/jessiegap.pdf 284.5 kB
  • PDF/jewellery-and-accessories.pdf 387.9 kB
  • PDF/jingle-bells.pdf 63.9 kB
  • PDF/job-ad.pdf 97.3 kB
  • PDF/job-interview-roleplay.pdf 116.7 kB
  • PDF/job.pdf 315.2 kB
  • PDF/job_001.pdf 731.8 kB
  • PDF/job_002.pdf 105.8 kB
  • PDF/Jobs And Professions.pdf 218.3 kB
  • PDF/jobs-2.pdf 463.4 kB
  • PDF/jobs-2012.pdf 426.2 kB
  • PDF/jobs-2012_001.pdf 426.2 kB
  • PDF/jobs-a.pdf 310.6 kB
  • PDF/jobs-and-numbers.pdf 101.6 kB
  • PDF/jobs-and-occupations-board-game.pdf 431.7 kB
  • PDF/jobs-and-professions.pdf 803.2 kB
  • PDF/jobs-animals-glash.pdf 1.2 MB
  • PDF/jobs-board-game-animals.pdf 854.8 kB
  • PDF/jobs-esl.pdf 534.5 kB
  • PDF/jobs-flash-cards.pdf 1.7 MB
  • PDF/jobs-flash-set-2012.pdf 3.4 MB
  • PDF/jobs-guessing-game.pdf 44.5 kB
  • PDF/jobs-ii.pdf 254.8 kB
  • PDF/jobs-iii.pdf 385.6 kB
  • PDF/jobs-matching.pdf 515.6 kB
  • PDF/jobs-queue.pdf 112.8 kB
  • PDF/jobs-word-jumbles1.pdf 823.6 kB
  • PDF/jobs-wordsearch.pdf 424.4 kB
  • PDF/jobs.pdf 21.9 kB
  • PDF/jobs2.pdf 378.0 kB
  • PDF/jobs3.pdf 467.1 kB
  • PDF/jobs_001.pdf 531.8 kB
  • PDF/jobs_002.pdf 176.5 kB
  • PDF/jobs_003.pdf 231.0 kB
  • PDF/jobs_004.pdf 75.6 kB
  • PDF/jobs_005.pdf 225.5 kB
  • PDF/john-lennon-imagine.pdf 114.2 kB
  • PDF/john-was-playing-basketball-when-i-saw-him.pdf 369.9 kB
  • PDF/jokes-lesson.pdf 45.4 kB
  • PDF/jonathan-ive-with-teachers-notes.pdf 4.4 MB
  • PDF/Judiciary Intermediate Word Search.pdf 208.6 kB
  • PDF/julia.pdf 81.7 kB
  • PDF/julia_001.pdf 81.7 kB
  • PDF/juliarobbie2.pdf 1.9 MB
  • PDF/july-august-calendar-symbols.pdf 73.3 kB
  • PDF/july-awards.pdf 92.8 kB
  • PDF/july-bulletin-boards.pdf 306.3 kB
  • PDF/july-calendar-header.pdf 57.1 kB
  • PDF/july-calendar.pdf 39.2 kB
  • PDF/july-calendars-coloring-pages.pdf 650.7 kB
  • PDF/july-fun-glasses.pdf 63.5 kB
  • PDF/july-important-dates.pdf 78.0 kB
  • PDF/june-activities.pdf 74.6 kB
  • PDF/june-al-e-gator.pdf 211.1 kB
  • PDF/june-bookmarks.pdf 274.6 kB
  • PDF/june-bulletin-boards.pdf 389.0 kB
  • PDF/june-calendar-1.pdf 503.2 kB
  • PDF/june-calendar.pdf 256.1 kB
  • PDF/june-happy-snake.pdf 169.0 kB
  • PDF/june-holidays.pdf 233.6 kB
  • PDF/june-snake-trail.pdf 166.8 kB
  • PDF/june-sneaky-snake.pdf 163.5 kB
  • PDF/june-standup-alligator.pdf 191.8 kB
  • PDF/june-star-award.pdf 170.3 kB
  • PDF/june-student-award.pdf 178.3 kB
  • PDF/june-summer-activities.pdf 216.2 kB
  • PDF/june-summer-kids.pdf 257.3 kB
  • PDF/june-summer-visor.pdf 180.6 kB
  • PDF/june-turtle-activities.pdf 269.6 kB
  • PDF/june-turtle-craft.pdf 175.6 kB
  • PDF/june-turtle-paper-bag-puppet.pdf 172.8 kB
  • PDF/june-turtle-pattern.pdf 174.7 kB
  • PDF/june-water-safety.pdf 196.1 kB
  • PDF/Junk Food.pdf 213.8 kB
  • PDF/junk-food-worksheet.pdf 118.1 kB
  • PDF/just-give-me-a-reason-pink.pdf 48.6 kB
  • PDF/just-or-already-cards.pdf 4.2 kB
  • PDF/just-rephrasing-key.pdf 83.3 kB
  • PDF/just-the-way-you-are.pdf 292.9 kB
  • PDF/just-the-way-you-are_001.pdf 145.9 kB
  • PDF/justin-bieber-beauty-and-a-beat.pdf 246.2 kB
  • PDF/k-pax-movie-worksheet.pdf 112.0 kB
  • PDF/karma-joss-stone-comparatives.pdf 40.7 kB
  • PDF/kate-perry.pdf 64.9 kB
  • PDF/katy-perry-firework-lp.pdf 107.2 kB
  • PDF/katy-perry-firework.pdf 529.6 kB
  • PDF/katy_perry_last-friday-night.pdf 617.7 kB
  • PDF/keep-ya-head-up.pdf 28.8 kB
  • PDF/keepyourheadup.pdf 103.1 kB
  • PDF/kelly-clarkson-stronger.pdf 209.4 kB
  • PDF/ken-wilbard-pesnya-sing-the-song.pdf 169.5 kB
  • PDF/key-word-make-double-puzzle.pdf 223.6 kB
  • PDF/kid-inventors.pdf 747.2 kB
  • PDF/kid-inventors_001.pdf 747.2 kB
  • PDF/kid-stuff-worksheet.pdf 168.0 kB
  • PDF/kidnap-the-sandy-claws.pdf 162.6 kB
  • PDF/kids-alphabet.pdf 1.3 MB
  • PDF/kids-food.pdf 240.2 kB
  • PDF/kiev-sightseeing-j.pdf 4.2 MB
  • PDF/kings speech intermediate.pdf 212.3 kB
  • PDF/kiss.pdf 265.7 kB
  • PDF/kitchen-action.pdf 972.1 kB
  • PDF/kitchen-actions.pdf 280.3 kB
  • PDF/kitchen-bingo.pdf 564.4 kB
  • PDF/kitchen-decoding.pdf 475.4 kB
  • PDF/kitchen-matching.pdf 413.9 kB
  • PDF/kitchen-utensils.pdf 544.2 kB
  • PDF/kitchen.pdf 350.8 kB
  • PDF/knock-knock-song.pdf 265.5 kB
  • PDF/knowing.pdf 34.7 kB
  • PDF/koala.pdf 187.7 kB
  • PDF/kony-2012-student-sheet.pdf 152.1 kB
  • PDF/kwanzaa-holiday.pdf 197.9 kB
  • PDF/l.pdf 175.4 kB
  • PDF/labrinth-beneath-your-beautiful.pdf 76.6 kB
  • PDF/lady-in-red.pdf 288.8 kB
  • PDF/landscape word search.pdf 218.1 kB
  • PDF/Landscape Words.pdf 216.3 kB
  • PDF/language-quiz1.pdf 169.0 kB
  • PDF/language.pdf 179.7 kB
  • PDF/last-christmas.pdf 72.4 kB
  • PDF/last-christmas_001.pdf 115.9 kB
  • PDF/last-christmas_002.pdf 1.1 MB
  • PDF/last-friday-night-katy-perry.pdf 134.9 kB
  • PDF/last-xmas.pdf 53.8 kB
  • PDF/laura-dekker-video-worksheet.pdf 72.6 kB
  • PDF/law-and-order.pdf 11.1 kB
  • PDF/laws.pdf 241.7 kB
  • PDF/lazy-bones.pdf 96.9 kB
  • PDF/leaf.pdf 717.6 kB
  • PDF/learn_to_spell.pdf 111.1 kB
  • PDF/learn_to_spell_001.pdf 111.1 kB
  • PDF/learn_vocab-article.pdf 58.3 kB
  • PDF/learning-english-collocations.pdf 307.0 kB
  • PDF/learning-l2.pdf 67.4 kB
  • PDF/leisure-boardgame.pdf 1.1 MB
  • PDF/lemon-tree.pdf 537.9 kB
  • PDF/lemon-tree_001.pdf 27.9 kB
  • PDF/lenka-everything-at-once.pdf 289.7 kB
  • PDF/lenka-without-words.pdf 403.4 kB
  • PDF/lenka.pdf 16.5 kB
  • PDF/lenka_everything-at-once.pdf 183.8 kB
  • PDF/leprech.pdf 168.4 kB
  • PDF/leprechaun.pdf 238.1 kB
  • PDF/les-adjectifs-de-personnalit.pdf 634.7 kB
  • PDF/lesson-2-daily-routines.pdf 332.5 kB
  • PDF/lesson-3-passive-voice.pdf 310.6 kB
  • PDF/lesson-5-bac-unit-1-upload.pdf 273.7 kB
  • PDF/lesson-plan-experiment-group.pdf 116.6 kB
  • PDF/lesson-plan-master-baker.pdf 339.8 kB
  • PDF/lessonplan5.pdf 561.5 kB
  • PDF/let-it-snow-project-frank-sinatra.pdf 684.4 kB
  • PDF/let-us-move-on-worksheet.pdf 220.5 kB
  • PDF/leta-talk-abot-e-mail.pdf 108.4 kB
  • PDF/lets-compare-people.pdf 547.9 kB
  • PDF/lets-go-shopping.pdf 234.9 kB
  • PDF/lets-go.pdf 53.7 kB
  • PDF/lets-sing-the-alphabet1.pdf 408.0 kB
  • PDF/lets-talk-about-negotiations.pdf 475.1 kB
  • PDF/letter-captain-w-persuasion.pdf 29.1 kB
  • PDF/letter-soup-animals.pdf 270.1 kB
  • PDF/letter.pdf 235.2 kB
  • PDF/letters-a-i.pdf 169.2 kB
  • PDF/level-2-what-do-you-want-to-do.pdf 55.1 kB
  • PDF/level-test.pdf 48.6 kB
  • PDF/level_1_conjunction_when1.pdf 21.5 kB
  • PDF/Librarianship wordsearch.pdf 218.2 kB
  • PDF/library-conv-test.pdf 44.4 kB
  • PDF/library-conv-test_001.pdf 44.4 kB
  • PDF/lie.pdf 215.8 kB
  • PDF/life-in-the-15th-century.pdf 242.8 kB
  • PDF/life-is-a-highway.pdf 51.0 kB
  • PDF/Lifestyles.pdf 217.9 kB
  • PDF/lightbulb.pdf 169.4 kB
  • PDF/like-dislike.pdf 2.6 MB
  • PDF/like-dislike_001.pdf 64.1 kB
  • PDF/like-or-dislike.pdf 125.0 kB
  • PDF/like.pdf 1.3 kB
  • PDF/likes-dislikes2.pdf 454.9 kB
  • PDF/lilo-and-stitch-movie-worksheet.pdf 49.6 kB
  • PDF/lily-allen-ldn.pdf 392.0 kB
  • PDF/limp-bizkit-eat-you-alive.pdf 142.2 kB
  • PDF/lincoln.pdf 1.9 MB
  • PDF/lines-for-christmast-role-play.pdf 155.2 kB
  • PDF/linkers-of-contrast-p70.pdf 159.1 kB
  • PDF/linking-2012.pdf 122.4 kB
  • PDF/linking-park.pdf 158.9 kB
  • PDF/linking-words-2013.pdf 76.8 kB
  • PDF/linking-words-activity.pdf 125.8 kB
  • PDF/linking-words-agosto-2012.pdf 279.1 kB
  • PDF/linking-words-practice.pdf 46.2 kB
  • PDF/linking-words-rephrasing.pdf 133.2 kB
  • PDF/linking-words.pdf 508.5 kB
  • PDF/list_of_prefixes.pdf 16.8 kB
  • PDF/list_of_suffixes.pdf 18.6 kB
  • PDF/listen-and-circle.pdf 155.9 kB
  • PDF/listen-to-a-song-by-keane.pdf 125.6 kB
  • PDF/listening-activity.pdf 50.3 kB
  • PDF/listening-activity_001.pdf 141.0 kB
  • PDF/listening-buying-property.pdf 39.7 kB
  • PDF/listening-carly-rea-jepsen-call-me-maybe.pdf 100.4 kB
  • PDF/listening-hollywood-marina-and-the-diamonds.pdf 213.9 kB
  • PDF/listening-i-believe-i-can-fly.pdf 51.5 kB
  • PDF/listening-jessie-ware-wildest-moments.pdf 63.2 kB
  • PDF/listening-oceana-put-your-gun-down.pdf 66.4 kB
  • PDF/listening-on-racism.pdf 60.3 kB
  • PDF/listening-speaking-creepy-crawlies.pdf 95.0 kB
  • PDF/listening-the-art-of-good-complaining.pdf 44.2 kB
  • PDF/literature.pdf 114.3 kB
  • PDF/Little Creatures Word Search.pdf 218.1 kB
  • PDF/little-boxes-song.pdf 183.4 kB
  • PDF/little-miss-sunshine-take-home-homework.pdf 116.3 kB
  • PDF/little-red-hen-role-play.pdf 55.3 kB
  • PDF/little-red-riding-hood-cut-text.pdf 48.0 kB
  • PDF/little-talks-worksheet.pdf 116.5 kB
  • PDF/little-talks.pdf 219.3 kB
  • PDF/little-things-one-direction.pdf 109.7 kB
  • PDF/little.pdf 45.5 kB
  • PDF/living-room.pdf 645.7 kB
  • PDF/living-room_001.pdf 133.8 kB
  • PDF/locked.pdf 248.7 kB
  • PDF/london-calling-by-the-clash.pdf 284.6 kB
  • PDF/london-crossword-puzzle.pdf 393.9 kB
  • PDF/london-places-of-interest.pdf 240.0 kB
  • PDF/london-quiz-pp.pdf 2.6 MB
  • PDF/london.pdf 188.0 kB
  • PDF/london_001.pdf 59.1 kB
  • PDF/london_002.pdf 10.1 MB
  • PDF/london_003.pdf 899.0 kB
  • PDF/london_quiz.pdf 919.7 kB
  • PDF/london_quiz_2.pdf 42.6 kB
  • PDF/long-live-taylor-swift.pdf 448.1 kB
  • PDF/look-at-the-fruit.pdf 134.1 kB
  • PDF/look-at-the-people.pdf 230.3 kB
  • PDF/look-at-the-picture-and-fill-in-the-gaps-with-the.pdf 317.9 kB
  • PDF/look-at-the-pictures.pdf 426.7 kB
  • PDF/lookback_board_game.pdf 1.1 MB
  • PDF/lookback_board_game_001.pdf 1.1 MB
  • PDF/lorax_movie_review.pdf 38.5 kB
  • PDF/lose-yourself-upper-intermediate.pdf 100.8 kB
  • PDF/lottery.pdf 188.3 kB
  • PDF/love-actually.pdf 132.4 kB
  • PDF/love-and-relationships-speaking-cards.pdf 55.4 kB
  • PDF/love-in-its-many-forms.pdf 68.6 kB
  • PDF/love-is-blindness.pdf 233.3 kB
  • PDF/love-of-my-life.pdf 40.0 kB
  • PDF/love-potion-no.pdf 342.0 kB
  • PDF/love-story-of-a-modern-era.pdf 666.1 kB
  • PDF/love-you-like-a-love-song-selena-gomez.pdf 43.1 kB
  • PDF/love.pdf 197.4 kB
  • PDF/love_001.pdf 46.7 kB
  • PDF/loving-you.pdf 59.3 kB
  • PDF/luck.pdf 127.9 kB
  • PDF/lucky.pdf 175.5 kB
  • PDF/lucy-doesn.pdf 43.8 kB
  • PDF/lyrics-flame-relay-olympics-2012-answers.pdf 50.2 kB
  • PDF/lyrics-flame-relay-olympics-2012.pdf 49.7 kB
  • PDF/lyrics-othello-rap.pdf 57.9 kB
  • PDF/lyrics-to-walking-in-the-air-with-words-taken-out.pdf 44.4 kB
  • PDF/lyrics-you-will-you-wont.pdf 228.9 kB
  • PDF/lyricsjeff-buckley-hallelujah.pdf 219.9 kB
  • PDF/madagascar-3-worksheet.pdf 390.6 kB
  • PDF/madagascar-worksheet.pdf 172.6 kB
  • PDF/madlib-personalad.pdf 201.9 kB
  • PDF/madonna-masterpiece.pdf 575.1 kB
  • PDF/madonna-more.pdf 87.3 kB
  • PDF/magnets.pdf 190.2 kB
  • PDF/make-or-do-collocations-key.pdf 422.0 kB
  • PDF/make-or-do-text.pdf 26.2 kB
  • PDF/make-or-do.pdf 295.5 kB
  • PDF/make-the-questions.pdf 130.7 kB
  • PDF/make-the-sentences-negative.pdf 41.2 kB
  • PDF/makeawish.pdf 267.4 kB
  • PDF/making-comparisons-copy.pdf 212.7 kB
  • PDF/making-nouns-plural.pdf 2.5 MB
  • PDF/making-questions.pdf 210.4 kB
  • PDF/making-suggestions-and-expressing-preferences_.pdf 15.4 kB
  • PDF/mamma-mia-beginning.pdf 93.2 kB
  • PDF/mamma-mia-lay-all-your-love-on-me.pdf 216.7 kB
  • PDF/mamma-mia-worksheet-key.pdf 101.1 kB
  • PDF/mamma-mia-worksheet.pdf 101.1 kB
  • PDF/mamma-mia.pdf 142.0 kB
  • PDF/mamma-mia_001.pdf 148.6 kB
  • PDF/mamma-mia_002.pdf 24.2 kB
  • PDF/mammamia.pdf 49.7 kB
  • PDF/mandela-invictus-worksheet.pdf 70.5 kB
  • PDF/manners-story-with-cards.pdf 37.6 kB
  • PDF/manners.pdf 32.5 kB
  • PDF/many_much_few_little.pdf 101.6 kB
  • PDF/map.pdf 377.0 kB
  • PDF/map_001.pdf 98.4 kB
  • PDF/map_activity.pdf 97.7 kB
  • PDF/march-bulletin-boards.pdf 174.6 kB
  • PDF/march-calendar-2.pdf 313.3 kB
  • PDF/march-calendar.pdf 299.9 kB
  • PDF/march-clipart.pdf 115.6 kB
  • PDF/marias.pdf 975.2 kB
  • PDF/mark-twain-biography-and-exercises.pdf 289.2 kB
  • PDF/maroon-5-one-more-night.pdf 66.4 kB
  • PDF/marshy_mask.pdf 144.6 kB
  • PDF/mary-max-exercises-on-the-animation.pdf 328.3 kB
  • PDF/mary-max-script-18-33.pdf 196.2 kB
  • PDF/mascots.pdf 246.0 kB
  • PDF/maslenitsa.pdf 41.0 kB
  • PDF/MASS MEDIA.pdf 220.0 kB
  • PDF/mass-media-reading.pdf 357.0 kB
  • PDF/masterpiece.pdf 53.0 kB
  • PDF/match-and-paint-food.pdf 106.2 kB
  • PDF/match-the-picture-in-this-table-to-the-country.pdf 505.0 kB
  • PDF/match-the-pictures-to-the-words.pdf 364.4 kB
  • PDF/matching-routines.pdf 39.7 kB
  • PDF/matching-sports-upload.pdf 176.9 kB
  • PDF/Materials Word Search.pdf 212.5 kB
  • PDF/materials.pdf 901.1 kB
  • PDF/matilda-handout.pdf 145.3 kB
  • PDF/may-activities.pdf 78.3 kB
  • PDF/may-awards.pdf 75.0 kB
  • PDF/may-bulletin-boards.pdf 186.0 kB
  • PDF/may-calendar-2.pdf 339.7 kB
  • PDF/may-calendar.pdf 410.5 kB
  • PDF/may-fun-glasses.pdf 65.8 kB
  • PDF/may-plants-and-flowers.pdf 214.1 kB
  • PDF/may-writing-template.pdf 50.1 kB
  • PDF/may.pdf 540.0 kB
  • PDF/meals-meal-times.pdf 99.1 kB
  • PDF/Meals.pdf 212.4 kB
  • PDF/means-of-transport-2011.pdf 882.0 kB
  • PDF/means-of-transport-2012.pdf 642.5 kB
  • PDF/means-of-transport-air.pdf 752.8 kB
  • PDF/means-of-transport.pdf 1.5 MB
  • PDF/MEASURES.pdf 218.1 kB
  • PDF/measuresposters2.pdf 1.9 MB
  • PDF/mechanics-assessment.pdf 179.6 kB
  • PDF/MEDIA BIAS.pdf 218.1 kB
  • PDF/Media Matters Word Search.pdf 220.3 kB
  • PDF/medical-tourism.pdf 155.7 kB
  • PDF/medieval-life.pdf 137.3 kB
  • PDF/meet-sandra-weird.pdf 37.3 kB
  • PDF/meettheparents.pdf 52.9 kB
  • PDF/melanie-fiona.pdf 98.1 kB
  • PDF/mem-flcard_clothes.pdf 471.9 kB
  • PDF/mem-flcard_numbers_1-16.pdf 43.8 kB
  • PDF/mem-flcard_numbers_20-59.pdf 44.2 kB
  • PDF/mem-flcard_numbers_60-99.pdf 44.4 kB
  • PDF/mem-flcard_pres-cont.pdf 362.5 kB
  • PDF/mem-flcard_short-a.pdf 337.5 kB
  • PDF/mem-flcard_short-u.pdf 239.4 kB
  • PDF/mem-flcard_there-is-are.pdf 384.8 kB
  • PDF/Memorial Day.pdf 214.3 kB
  • PDF/memory-game.pdf 154.2 kB
  • PDF/memory.pdf 276.6 kB
  • PDF/mens-wear.pdf 257.0 kB
  • PDF/mens-wera-pict.pdf 953.8 kB
  • PDF/merlin-season-1-episode-2-w.pdf 234.2 kB
  • PDF/mery-madagascar-task.pdf 352.0 kB
  • PDF/message-a-and-b-roleplay.pdf 55.5 kB
  • PDF/messi.pdf 1.7 MB
  • PDF/metaphors.pdf 72.3 kB
  • PDF/mexican-flag.pdf 277.2 kB
  • PDF/mice-dialogo.pdf 116.6 kB
  • PDF/microsoft-excel-basic-mac.pdf 76.6 kB
  • PDF/microsoft-excel.pdf 46.1 kB
  • PDF/microsoft-word-review.pdf 58.3 kB
  • PDF/MILITARY.pdf 212.0 kB
  • PDF/million.pdf 274.7 kB
  • PDF/mind-your-language-episodes-1-28.pdf 82.5 kB
  • PDF/mind-your-language1.pdf 150.4 kB
  • PDF/mingle.pdf 64.5 kB
  • PDF/mini-book-meu.pdf 181.7 kB
  • PDF/miniposter.pdf 576.8 kB
  • PDF/miscellaneous-exam.pdf 58.5 kB
  • PDF/miscellanous-test-first-term.pdf 33.0 kB
  • PDF/miserable.pdf 233.9 kB
  • PDF/miss-universe-handout.pdf 171.9 kB
  • PDF/missing-classroom-supplies.pdf 377.8 kB
  • PDF/mistakes-that-everybody-makes.pdf 12.2 kB
  • PDF/mistletoe-and-wine-song.pdf 310.1 kB
  • PDF/mistletoe-and-wine.pdf 59.0 kB
  • PDF/mistletoe-justin-bieber.pdf 487.2 kB
  • PDF/mixed-conditional-clauses.pdf 149.7 kB
  • PDF/mixed-prepositions.pdf 116.1 kB
  • PDF/mixed-rephrasing-2-active-direct-speech-key.pdf 77.8 kB
  • PDF/mixed-reprhasing-1-passive-reported-key.pdf 77.3 kB
  • PDF/mixed-tense-revision-present-tense.pdf 72.1 kB
  • PDF/Mobile Telephones.pdf 218.3 kB
  • PDF/modal-table-by-missbluebird-on-busy-teacher.pdf 9.8 kB
  • PDF/modal-verbs-dec2012.pdf 138.9 kB
  • PDF/modal-verbs-explanation-and-exercise.pdf 155.7 kB
  • PDF/modal-verbs-have-to-ought.pdf 729.3 kB
  • PDF/modal-verbs-intermediate-ii.pdf 335.0 kB
  • PDF/modal-verbs-key.pdf 104.4 kB
  • PDF/modal-verbs.pdf 426.4 kB
  • PDF/modal.pdf 434.6 kB
  • PDF/modal_001.pdf 470.8 kB
  • PDF/modalexercises.pdf 37.6 kB
  • PDF/modals-of-deduction.pdf 58.2 kB
  • PDF/modals_cards_lang_2012.pdf 14.7 kB
  • PDF/modalshavev3.pdf 19.9 kB
  • PDF/modalverbs.pdf 60.7 kB
  • PDF/modern-family-2x08.pdf 463.1 kB
  • PDF/monday-madness-game.pdf 784.1 kB
  • PDF/monday-morning.pdf 525.0 kB
  • PDF/Money and Finances Intermediate Word Search.pdf 220.0 kB
  • PDF/money-and-finance-vocabulary-activity.pdf 41.7 kB
  • PDF/money-images-and-vocab.pdf 412.8 kB
  • PDF/money-worksheet.pdf 144.9 kB
  • PDF/Money.pdf 215.0 kB
  • PDF/money_001.pdf 4.2 MB
  • PDF/money_last_exercise.pdf 24.0 kB
  • PDF/moneyvocabtaboo.pdf 123.9 kB
  • PDF/monkey-puzzle.pdf 1.4 MB
  • PDF/monster-high.pdf 273.0 kB
  • PDF/monster_high_kids.pdf 216.9 kB
  • PDF/monster_high_kidsplus.pdf 270.9 kB
  • PDF/monsters-inc-adjective-worksheet-beginner-and.pdf 65.5 kB
  • PDF/monsters-inc-descriptions-and-worksheet.pdf 556.2 kB
  • PDF/monsters-inc.pdf 71.3 kB
  • PDF/monsters.pdf 253.5 kB
  • PDF/months-dates-ordinals-cardinals.pdf 498.1 kB
  • PDF/months-of-the-year-made-by-pentelinka.pdf 4.0 MB
  • PDF/months-of-the-year-poster.pdf 178.8 kB
  • PDF/months.pdf 10.7 kB
  • PDF/moon-landing-you-tube-activity.pdf 172.7 kB
  • PDF/moonshadow-and-superstitions-first-conditional.pdf 750.9 kB
  • PDF/moonshadow-cat-stevens-exercises-song-first.pdf 1.0 MB
  • PDF/more-than-words.pdf 278.1 kB
  • PDF/mother-day.pdf 132.9 kB
  • PDF/Mother.pdf 215.5 kB
  • PDF/Mother_001.pdf 212.7 kB
  • PDF/mothers-day-activities.pdf 80.0 kB
  • PDF/mothers-day-hearts.pdf 61.7 kB
  • PDF/mothers-day-make-mom-happy-game.pdf 268.4 kB
  • PDF/mothers-day-poem.pdf 108.9 kB
  • PDF/mothers-day-standup-flowers.pdf 92.7 kB
  • PDF/mothers-day-wish-express.pdf 168.0 kB
  • PDF/mothers-of-the-wild.pdf 459.4 kB
  • PDF/mothersday.pdf 31.3 kB
  • PDF/Movie Vocabulary.pdf 216.1 kB
  • PDF/movie-activity-kung-fu-panda-2.pdf 231.8 kB
  • PDF/movie-activity-the-devil-inside.pdf 48.7 kB
  • PDF/movie-paranorman.pdf 544.8 kB
  • PDF/movie-worksheet-witness-by-peter-weir.pdf 107.8 kB
  • PDF/movie_crossword.pdf 52.4 kB
  • PDF/movies-vocabulary.pdf 1.6 MB
  • PDF/mpk_close.pdf 379.2 kB
  • PDF/mpk_poster.pdf 1.9 MB
  • PDF/mpk_poster2.pdf 2.2 MB
  • PDF/mpk_tips.pdf 847.0 kB
  • PDF/mpk_worksheet.pdf 379.5 kB
  • PDF/mr-bean-at-the-restaurant-video-activity.pdf 52.2 kB
  • PDF/mr-bean-cards.pdf 691.5 kB
  • PDF/mr-bean-goes-to-a-judo-class-video-activity.pdf 51.4 kB
  • PDF/mr-saxo-beat.pdf 249.8 kB
  • PDF/mr-shamrock.pdf 74.3 kB
  • PDF/mr.pdf 97.8 kB
  • PDF/mr_001.pdf 85.1 kB
  • PDF/mr_002.pdf 149.7 kB
  • PDF/mrs-lilia-gammoudi-human-rights.pdf 134.4 kB
  • PDF/mrs-ramsey.pdf 27.1 kB
  • PDF/mrs-rich-poor.pdf 80.8 kB
  • PDF/mrs.pdf 53.0 kB
  • PDF/msl_0511_mdnewspaper_card.pdf 131.2 kB
  • PDF/mt-2-degrees-of-comparison-worksheets.pdf 386.3 kB
  • PDF/muallems.pdf 53.6 kB
  • PDF/much-many-a-lot-of.pdf 940.0 kB
  • PDF/mum-not-eating-1.pdf 46.4 kB
  • PDF/muse-cant-take-my-eyes-off-you.pdf 1.2 MB
  • PDF/muse-survival-future-tenses-worksheet.pdf 195.5 kB
  • PDF/music-talk.pdf 28.6 kB
  • PDF/music-writing-worksheet.pdf 256.0 kB
  • PDF/music.pdf 240.8 kB
  • PDF/Musical instruments.pdf 218.3 kB
  • PDF/musical-instruments-target-board.pdf 93.5 kB
  • PDF/musical-instruments.pdf 183.1 kB
  • PDF/musical-writing.pdf 193.2 kB
  • PDF/musical20111.pdf 696.8 kB
  • PDF/musicians.pdf 311.1 kB
  • PDF/must-school-rules.pdf 36.5 kB
  • PDF/must.pdf 230.7 kB
  • PDF/My breakfast.pdf 212.0 kB
  • PDF/My family.pdf 218.3 kB
  • PDF/My House.pdf 207.5 kB
  • PDF/my-eating-habits.pdf 191.9 kB
  • PDF/my-family.pdf 44.2 kB
  • PDF/my-family_001.pdf 99.7 kB
  • PDF/my-father.pdf 64.0 kB
  • PDF/my-friends.pdf 250.9 kB
  • PDF/my-happy-ending.pdf 57.4 kB
  • PDF/my-life-story.pdf 323.5 kB
  • PDF/my-life.pdf 90.4 kB
  • PDF/my-new-year-book.pdf 183.9 kB
  • PDF/my-ny-resolutions.pdf 48.1 kB
  • PDF/my-own-planet.pdf 24.1 kB
  • PDF/my-own-time-capsule-1st-class.pdf 1.6 MB
  • PDF/my-pet.pdf 68.0 kB
  • PDF/my-prefixes.pdf 2.3 MB
  • PDF/my-pyramid-grades1-2.pdf 4.3 MB
  • PDF/my-pyramid-nutrition-gr5-6.pdf 3.0 MB
  • PDF/my-school-timetable.pdf 441.7 kB
  • PDF/my-suffixes.pdf 2.5 MB
  • PDF/my-summer-book.pdf 35.5 kB
  • PDF/my_home_town.pdf 461.2 kB
  • PDF/my_room.pdf 96.9 kB
  • PDF/my_tine_grammar__inversion.pdf 35.0 kB
  • PDF/my_tine_grammar__inversion_001.pdf 35.0 kB
  • PDF/myfamily.pdf 1.0 MB
  • PDF/mypyramidbrochurebyific.pdf 592.6 kB
  • PDF/name-mobiles.pdf 53.4 kB
  • PDF/name.pdf 362.5 kB
  • PDF/names-people-country-alphabet-game.pdf 14.1 kB
  • PDF/names_to_know.pdf 161.6 kB
  • PDF/naming-pictures.pdf 307.0 kB
  • PDF/narrative-by-me.pdf 61.6 kB
  • PDF/national_friends.pdf 38.5 kB
  • PDF/nationalities-and-jobs.pdf 580.8 kB
  • PDF/NATIONALITIES.pdf 218.0 kB
  • PDF/nationalitieswordsearch.pdf 569.3 kB
  • PDF/nationality.pdf 1.4 MB
  • PDF/natual-and-human-landscapes.pdf 3.6 MB
  • PDF/NATURAL DISASTERS WORD SEARCH.pdf 219.9 kB
  • PDF/natural-disasters.pdf 476.5 kB
  • PDF/natural-disasters_001.pdf 137.0 kB
  • PDF/nature-environment-weather-animals.pdf 441.9 kB
  • PDF/nature.pdf 133.1 kB
  • PDF/nature_001.pdf 486.8 kB
  • PDF/necessities.pdf 11.6 kB
  • PDF/negative prefixes.pdf 220.1 kB
  • PDF/negative-prefixes.pdf 72.9 kB
  • PDF/negotiation-roleplays.pdf 32.7 kB
  • PDF/new-girl-pilot.pdf 483.1 kB
  • PDF/new-girl.pdf 34.0 kB
  • PDF/new-manners-1.pdf 1.3 MB
  • PDF/new-microsoft-word-document.pdf 39.9 kB
  • PDF/new-taboo.pdf 438.4 kB
  • PDF/new-vocabulary_london.pdf 304.9 kB
  • PDF/new-year-2.pdf 835.2 kB
  • PDF/new-year-2012-pict.pdf 576.1 kB
  • PDF/new-year-flashcards.pdf 790.7 kB
  • PDF/new-year-hyy_newyear_pledge.pdf 126.9 kB
  • PDF/new-year-match.pdf 935.6 kB
  • PDF/new-year-resolutions.pdf 43.3 kB
  • PDF/new-years-resolutions.pdf 258.9 kB
  • PDF/new-york-vs-vienna_-comparison.pdf 121.4 kB
  • PDF/new-york.pdf 1.5 MB
  • PDF/new-york_001.pdf 2.0 MB
  • PDF/newyears.pdf 91.0 kB
  • PDF/ng-s01e02.pdf 34.1 kB
  • PDF/nicks-favorite-day.pdf 102.9 kB
  • PDF/nicky-was-mugged.pdf 806.1 kB
  • PDF/nightat-the-museum2-worksh.pdf 2.5 MB
  • PDF/no-sunshin.pdf 354.6 kB
  • PDF/nocolor.pdf 182.4 kB
  • PDF/nola-aldatu-aktibatik-pasibara.pdf 24.7 kB
  • PDF/none-of-us-are-free.pdf 171.4 kB
  • PDF/nonsense-have-you-ever.pdf 80.6 kB
  • PDF/normas-de-clase-para-colorear.pdf 529.3 kB
  • PDF/nothing-else-matters.pdf 117.4 kB
  • PDF/noughts-and-crosses-with-conditionals.pdf 17.2 kB
  • PDF/noun-formation-suffix.pdf 120.2 kB
  • PDF/noun-modifiers.pdf 487.9 kB
  • PDF/nouns-and-pronouns.pdf 77.0 kB
  • PDF/nouns-plural-boardgame.pdf 754.3 kB
  • PDF/nouns.pdf 295.4 kB
  • PDF/nouns_001.pdf 59.6 kB
  • PDF/nov-2010.pdf 419.0 kB
  • PDF/november-bookmarks.pdf 216.1 kB
  • PDF/november-calendar.pdf 327.8 kB
  • PDF/november-worksheets-collection.pdf 7.9 MB
  • PDF/nujood-ali-1-2008-los-angeles-times.pdf 112.3 kB
  • PDF/nujood-ali-2-after-the-divorce.pdf 61.2 kB
  • PDF/number-1-10.pdf 268.9 kB
  • PDF/number-and-vocab-practice-shared.pdf 143.5 kB
  • PDF/numbers 1 to 20.pdf 212.2 kB
  • PDF/NUMBERS Word Search.pdf 206.5 kB
  • PDF/numbers-1-10-chant.pdf 27.2 kB
  • PDF/numbers-1-10.pdf 395.2 kB
  • PDF/numbers-1-12.pdf 2.0 MB
  • PDF/numbers-1-to-10-cute-pictionary-poster-vocabulary.pdf 893.8 kB
  • PDF/numbers-2012-elementary.pdf 22.0 kB
  • PDF/numbers-and-animals.pdf 429.5 kB
  • PDF/numbers-board-game-new.pdf 723.4 kB
  • PDF/numbers-flash-1.pdf 549.6 kB
  • PDF/numbers-flashcards-a4.pdf 682.2 kB
  • PDF/numbers-from-0-to-9.pdf 218.8 kB
  • PDF/numbers-game.pdf 276.1 kB
  • PDF/numbers-lesson.pdf 73.3 kB
  • PDF/numbers-practice-exercises-pdf.pdf 180.5 kB
  • PDF/numbers-skolka.pdf 50.6 kB
  • PDF/numbers-subjects.pdf 50.9 kB
  • PDF/numbers.pdf 39.1 kB
  • PDF/numbers10-20.pdf 39.1 kB
  • PDF/numbers_001.pdf 34.1 kB
  • PDF/numbers_002.pdf 2.3 MB
  • PDF/numbers_003.pdf 195.3 kB
  • PDF/numbers_004.pdf 1.2 MB
  • PDF/numberscrossword.pdf 547.8 kB
  • PDF/numberwords.pdf 436.0 kB
  • PDF/nutrition-1.pdf 144.6 kB
  • PDF/nutrition-2.pdf 183.3 kB
  • PDF/nutrition-3.pdf 296.4 kB
  • PDF/nutrition-4.pdf 2.5 MB
  • PDF/nutrition-5.pdf 244.3 kB
  • PDF/nutrition-6.pdf 42.0 kB
  • PDF/nutrition-7.pdf 408.2 kB
  • PDF/nutrition-8.pdf 90.1 kB
  • PDF/nutrition-grades-3-4.pdf 2.3 MB
  • PDF/nyl-pre.pdf 71.8 kB
  • PDF/obamas-victory-speech.pdf 165.0 kB
  • PDF/object-pronouns.pdf 24.6 kB
  • PDF/objects3.pdf 148.4 kB
  • PDF/occupation.pdf 1.1 MB
  • PDF/OCCUPATIONS Word Search.pdf 206.6 kB
  • PDF/occupations-with-footer.pdf 117.2 kB
  • PDF/occupations1.pdf 1.2 MB
  • PDF/occupations2.pdf 443.0 kB
  • PDF/occupations2_001.pdf 1.0 MB
  • PDF/oct-2010.pdf 283.1 kB
  • PDF/oct.pdf 386.0 kB
  • PDF/october.pdf 264.6 kB
  • PDF/office-supplies.pdf 757.4 kB
  • PDF/office.pdf 496.9 kB
  • PDF/office_notes3.pdf 1.8 MB
  • PDF/officenotes_081506.pdf 1.3 MB
  • PDF/og243lne.pdf 24.6 kB
  • PDF/oh-suzanna.pdf 73.3 kB
  • PDF/oh_no_not_hangman_again.pdf 115.8 kB
  • PDF/oldman.pdf 248.1 kB
  • PDF/olympic-country-profiles-worksheet.pdf 269.4 kB
  • PDF/olympic-games-elementary-word-search.pdf 224.8 kB
  • PDF/olympic-sports-wordsearch.pdf 606.2 kB
  • PDF/olympics-song-proud.pdf 130.9 kB
  • PDF/Olympics.pdf 218.9 kB
  • PDF/olympics_001.pdf 307.6 kB
  • PDF/on-holiday.pdf 1.1 MB
  • PDF/on-tap-he-7-len-8.pdf 158.1 kB
  • PDF/one-direction-beautiful-song-worksheet.pdf 469.9 kB
  • PDF/one-life-james-morrison-worksheet.pdf 26.6 kB
  • PDF/one-love-song-bob-marley.pdf 118.9 kB
  • PDF/one-of-us-complete.pdf 277.2 kB
  • PDF/one-thing-one-direction.pdf 40.6 kB
  • PDF/onewoman.pdf 77.2 kB
  • PDF/onomatopoeia.pdf 41.7 kB
  • PDF/open-questions-for-esl-teaching.pdf 434.8 kB
  • PDF/open-shut-them.pdf 178.7 kB
  • PDF/opinion-nl.pdf 58.1 kB
  • PDF/Opposite Adjectives NEF Pre-Intermediate Unit 4.pdf 214.3 kB
  • PDF/opposite-adjectives2.pdf 867.1 kB
  • PDF/opposite-word-find-with-key.pdf 742.7 kB
  • PDF/opposite_moves.pdf 207.3 kB
  • PDF/opposite_moves_001.pdf 207.3 kB
  • PDF/opposites-and-pairs.pdf 58.9 kB
  • PDF/opposites-attract.pdf 700.9 kB
  • PDF/opposites-mini.pdf 587.8 kB
  • PDF/opposites-word-puzzle.pdf 243.7 kB
  • PDF/oral-presentation-rubric.pdf 56.0 kB
  • PDF/orchestra-test.pdf 484.0 kB
  • PDF/orderofadjectives.pdf 122.2 kB
  • PDF/ordinal-game.pdf 173.4 kB
  • PDF/ordinal-game_001.pdf 817.7 kB
  • PDF/ordinal-numbers-dice.pdf 224.0 kB
  • PDF/ordinal-numbers.pdf 35.6 kB
  • PDF/ordinal-numbers_001.pdf 74.8 kB
  • PDF/ordinal-numerals.pdf 486.8 kB
  • PDF/ordinal-poster.pdf 986.4 kB
  • PDF/ordinal-t.pdf 325.7 kB
  • PDF/ordinal_numbers_original.pdf 421.6 kB
  • PDF/ordinary-day-cranberries.pdf 262.1 kB
  • PDF/OSCAR word puzzle.pdf 212.4 kB
  • PDF/ough-exercise.pdf 12.4 kB
  • PDF/ough-what-a-story-student.pdf 40.7 kB
  • PDF/ough-what-a-story.pdf 42.9 kB
  • PDF/Our Solar System.pdf 207.5 kB
  • PDF/our-life-in-seconds.pdf 72.8 kB
  • PDF/our-pastime-poem.pdf 50.3 kB
  • PDF/our-solar-system.pdf 51.3 kB
  • PDF/outlaw-words-assessment.pdf 188.1 kB
  • PDF/outlaw-words-spelling-assessment.pdf 197.6 kB
  • PDF/overview-of-conditionals.pdf 311.8 kB
  • PDF/overview-of-passive.pdf 118.2 kB
  • PDF/owlie-floods.pdf 861.1 kB
  • PDF/owlie-hurricane.pdf 898.2 kB
  • PDF/owlie-lightning.pdf 943.6 kB
  • PDF/owlie-tornado.pdf 1.0 MB
  • PDF/owlie-winter.pdf 1.0 MB
  • PDF/owlieskywarnbrochure.pdf 1.7 MB
  • PDF/p.pdf 26.3 kB
  • PDF/p1-u2-famous-cities-ads.pdf 537.5 kB
  • PDF/pages-from-lets-learn.pdf 257.3 kB
  • PDF/paint-my-love.pdf 583.2 kB
  • PDF/pair_work-jobs2.pdf 740.7 kB
  • PDF/pairwork.pdf 215.9 kB
  • PDF/pairwork_001.pdf 109.6 kB
  • PDF/pancakes.pdf 68.5 kB
  • PDF/panda-kung-fu.pdf 265.7 kB
  • PDF/paper-tube-zoo.pdf 294.8 kB
  • PDF/paperman.pdf 32.6 kB
  • PDF/paradise-coldplaly.pdf 52.7 kB
  • PDF/paralympics.pdf 122.4 kB
  • PDF/paralympicsnew.pdf 2.2 MB
  • PDF/parents_marijuana_brochure.pdf 520.2 kB
  • PDF/part-v-my-own-production.pdf 107.1 kB
  • PDF/partial-translations.pdf 187.0 kB
  • PDF/Participle Wordsearch.pdf 220.8 kB
  • PDF/participle-clause-exercisesb.pdf 47.6 kB
  • PDF/Parts of the Body Elementary Word Search.pdf 216.0 kB
  • PDF/Parts of the Body Word Search.pdf 216.2 kB
  • PDF/parts-of-a-car.pdf 670.5 kB
  • PDF/parts-of-clothing-voab.pdf 121.8 kB
  • PDF/parts-of-speech.pdf 2.7 MB
  • PDF/parts-of-the-body-busy-teachers.pdf 167.2 kB
  • PDF/parts-of-the-body-collage-poster.pdf 25.9 kB
  • PDF/parts-of-the-body-iii.pdf 479.4 kB
  • PDF/parts-of-the-body-poster-2012.pdf 195.4 kB
  • PDF/parts-of-the-body-sizzlin.pdf 335.4 kB
  • PDF/parts-of-the-body.pdf 680.7 kB
  • PDF/parts-of-the-body_001.pdf 137.0 kB
  • PDF/parts-of-the-house.pdf 61.3 kB
  • PDF/parts-of-the-house_001.pdf 141.6 kB
  • PDF/partsofahouse.pdf 37.0 kB
  • PDF/party_planner.pdf 658.6 kB
  • PDF/pass-the-parcel-load-of-words.pdf 20.2 kB
  • PDF/passado-was-e-were.pdf 390.5 kB
  • PDF/passive-2011-2.pdf 178.6 kB
  • PDF/passive-2011.pdf 234.3 kB
  • PDF/passive-did-you-know-pre-int.pdf 408.7 kB
  • PDF/passive-voice-ana.pdf 290.4 kB
  • PDF/passive-voice-for-busy-teachers.pdf 6.9 MB
  • PDF/passive-voice-hurricane-sandy.pdf 58.7 kB
  • PDF/passive-voice.pdf 229.5 kB
  • PDF/passive-voice_001.pdf 59.3 kB
  • PDF/passive-voice_002.pdf 73.6 kB
  • PDF/passive-voice_003.pdf 258.7 kB
  • PDF/passive-voice_explanation.pdf 534.7 kB
  • PDF/passive-voicepresent-continuous.pdf 159.8 kB
  • PDF/passive-with-past-simple.pdf 109.2 kB
  • PDF/passive_cards.pdf 311.7 kB
  • PDF/passive_report.pdf 40.6 kB
  • PDF/passivequiz.pdf 38.5 kB
  • PDF/passivevoiceexercises.pdf 2.9 kB
  • PDF/past-and-past-love-wh-questions-marie-andr233.pdf 250.4 kB
  • PDF/past-and-present_-dominoes.pdf 27.9 kB
  • PDF/past-continuous-2013.pdf 80.8 kB
  • PDF/past-continuous-cards.pdf 553.9 kB
  • PDF/past-continuous-tense.pdf 63.8 kB
  • PDF/past-continuous-tense2.pdf 421.7 kB
  • PDF/past-continuous.pdf 289.5 kB
  • PDF/past-detective-suspect-dialogue-role-play-gap.pdf 76.5 kB
  • PDF/past-experiences.pdf 112.1 kB
  • PDF/past-modals_degrees-of-certainty.pdf 85.9 kB
  • PDF/past-modals_should-neednt-have.pdf 247.7 kB
  • PDF/past-participles-of-irregular-verbs.pdf 221.0 kB
  • PDF/past-perfect-form.pdf 31.3 kB
  • PDF/past-perfect.pdf 77.4 kB
  • PDF/past-police-witness-dialogue-role-play-gap-fill.pdf 97.1 kB
  • PDF/past-progressive.pdf 282.5 kB
  • PDF/past-simple-and-continuous_-ana.pdf 255.5 kB
  • PDF/past-simple-and-past-c_lesson.pdf 110.9 kB
  • PDF/past-simple-board-game-2011.pdf 315.7 kB
  • PDF/past-simple-exercises.pdf 29.1 kB
  • PDF/past-simple-game.pdf 351.7 kB
  • PDF/past-simple-irregular-2012.pdf 137.0 kB
  • PDF/past-simple-listening-katy-perry-pre-intermediate.pdf 107.4 kB
  • PDF/past-simple-or-continuous-key.pdf 485.8 kB
  • PDF/past-simple-past-perfect.pdf 361.4 kB
  • PDF/past-simple-perfect-present-perfect.pdf 147.3 kB
  • PDF/past-simple-poster.pdf 328.6 kB
  • PDF/past-simple-present-perfect-gap-filling-key.pdf 469.5 kB
  • PDF/past-simple-present-perfect.pdf 50.3 kB
  • PDF/past-simple-questions.pdf 491.8 kB
  • PDF/past-simple-regular-2012.pdf 143.0 kB
  • PDF/past-simple-set.pdf 136.7 kB
  • PDF/past-simple-tense-exercises.pdf 39.3 kB
  • PDF/past-simple-test.pdf 114.8 kB
  • PDF/past-simple-to-be-dec2012.pdf 458.8 kB
  • PDF/past-simple-vs-past-continuous-2013.pdf 140.1 kB
  • PDF/past-simple-vs-past-continuous.pdf 183.6 kB
  • PDF/past-simple-vs-present-perfect-and-past-perfect.pdf 312.1 kB
  • PDF/past-simple-vs-present-perfect.pdf 230.3 kB
  • PDF/past-simple-vs.pdf 69.8 kB
  • PDF/past-simple-worksheet.pdf 55.6 kB
  • PDF/past-simple-worksheet_001.pdf 255.1 kB
  • PDF/past-simple.pdf 204.8 kB
  • PDF/past-simple2-mio.pdf 173.7 kB
  • PDF/past-simple_001.pdf 405.2 kB
  • PDF/past-simple_002.pdf 1.7 MB
  • PDF/past-simple_003.pdf 82.9 kB
  • PDF/past-simple_past-perfect-continuous.pdf 3.1 MB
  • PDF/past-simplepast-continous-and-past-perfect.pdf 521.1 kB
  • PDF/past-tense-board-game.pdf 358.2 kB
  • PDF/past-tense-practice.pdf 20.4 kB
  • PDF/past-tenses.pdf 41.5 kB
  • PDF/past-tensesmine.pdf 166.1 kB
  • PDF/past_simple.pdf 417.2 kB
  • PDF/pastparticiplememorygamelevel32a.pdf 117.2 kB
  • PDF/patterns.pdf 1.1 MB
  • PDF/patty-cake.pdf 357.1 kB
  • PDF/pay-it-forward-questions-and-vocab-0000-4000.pdf 252.7 kB
  • PDF/payphone.pdf 73.2 kB
  • PDF/pdfpuzzle.pdf 220.9 kB
  • PDF/pearl-jam-last-kiss.pdf 34.7 kB
  • PDF/penelope-cruz-on-david-letterman-sp.pdf 344.1 kB
  • PDF/penelopecruz.pdf 36.5 kB
  • PDF/penny-gives-sheldon-a-christmas-gift.pdf 152.1 kB
  • PDF/People and Family.pdf 216.1 kB
  • PDF/people at work elementary wordsearch.pdf 215.7 kB
  • PDF/people-are-strange-by-the-door1.pdf 82.7 kB
  • PDF/people-in-my-town.pdf 39.7 kB
  • PDF/people-say-assume-believe.pdf 40.9 kB
  • PDF/people.pdf 201.4 kB
  • PDF/peoples-daily-routine.pdf 478.3 kB
  • PDF/perfect-tense-review_with-resume.pdf 96.9 kB
  • PDF/perfil.pdf 167.0 kB
  • PDF/persepolis-ws.pdf 282.6 kB
  • PDF/personal-2011.pdf 202.7 kB
  • PDF/personal-and-possessive-pronouns.pdf 203.3 kB
  • PDF/personal-characteristics.pdf 109.0 kB
  • PDF/personal-pronoun-y-verb-to-be.pdf 46.2 kB
  • PDF/personal-pronouns-2011.pdf 260.3 kB
  • PDF/personal-pronouns-and-possessive-adjectives.pdf 120.0 kB
  • PDF/personal-pronouns-subject.pdf 256.8 kB
  • PDF/personal-pronouns.pdf 24.3 kB
  • PDF/personal-pronouns_001.pdf 528.1 kB
  • PDF/personal_narrative.pdf 1.2 MB
  • PDF/personal_narrative_001.pdf 1.2 MB
  • PDF/personal_qualities.pdf 110.8 kB
  • PDF/personal_qualities_001.pdf 110.8 kB
  • PDF/Personality Adjectives.pdf 212.4 kB
  • PDF/Personality adjectives_001.pdf 218.2 kB
  • PDF/personality adjectives_002.pdf 218.1 kB
  • PDF/personality-adjectives-2012-intermediate.pdf 461.8 kB
  • PDF/personality-adjectives1.pdf 215.0 kB
  • PDF/personality-traits-bingo.pdf 117.9 kB
  • PDF/personality.pdf 88.4 kB
  • PDF/personality_001.pdf 88.4 kB
  • PDF/Personality_002.pdf 212.6 kB
  • PDF/personality_003.pdf 178.6 kB
  • PDF/peruvian-animals-4.pdf 455.8 kB
  • PDF/pet-peeves-discussion-worksheet.pdf 338.0 kB
  • PDF/pet-peeves.pdf 199.6 kB
  • PDF/peter-gabriel-michael-jackson.pdf 68.1 kB
  • PDF/pets_activity.pdf 65.3 kB
  • PDF/pf_01_lessons_01.pdf 23.1 kB
  • PDF/pf_01_lessons_01_001.pdf 23.1 kB
  • PDF/pf_01_lessons_teacher_01.pdf 42.0 kB
  • PDF/pf_01_lessons_teacher_01_001.pdf 42.0 kB
  • PDF/phone-phrases-insert-and-practice.pdf 529.4 kB
  • PDF/phone.pdf 222.8 kB
  • PDF/phonemic-awareness-assessments.pdf 177.1 kB
  • PDF/phones.pdf 850.3 kB
  • PDF/phonetic-alphabet.pdf 57.8 kB
  • PDF/phonetics-vs-spelling.pdf 1.8 MB
  • PDF/phonetics-worksheet-1.pdf 92.5 kB
  • PDF/phonics-game.pdf 420.7 kB
  • PDF/phonics_vowels_copy.pdf 35.7 kB
  • PDF/phonological-exercise.pdf 47.0 kB
  • PDF/photos-as-food-for-thought.pdf 889.9 kB
  • PDF/Phrasal Verbs Word Search.pdf 218.2 kB
  • PDF/Phrasal Verbs.pdf 218.9 kB
  • PDF/Phrasal verbs_001.pdf 220.4 kB
  • PDF/phrasal-verbs-down.pdf 473.7 kB
  • PDF/phrasal-verbs-lisa.pdf 186.1 kB
  • PDF/phrasal-verbs-solutions-u-int.pdf 52.3 kB
  • PDF/phrasal-verbs-with-come.pdf 346.0 kB
  • PDF/phrasal-verbs-with-off-and-up.pdf 366.3 kB
  • PDF/phrasal-verbs-with-up.pdf 352.4 kB
  • PDF/phrasal-verbs-wordsearch.pdf 2.4 MB
  • PDF/phrasal-verbs.pdf 264.8 kB
  • PDF/phrasal-verbs1.pdf 228.2 kB
  • PDF/phrasal_verbs_list.pdf 139.4 kB
  • PDF/phrasalverbdown.pdf 33.8 kB
  • PDF/phrasalverbsup.pdf 413.8 kB
  • PDF/phrasalverbsup_001.pdf 42.7 kB
  • PDF/phrases-with-get.pdf 72.9 kB
  • PDF/physical-appea.pdf 59.9 kB
  • PDF/physical-appearence-cards.pdf 462.3 kB
  • PDF/physical-description.pdf 48.5 kB
  • PDF/physical-description_001.pdf 209.3 kB
  • PDF/pics-things-in-the-kitchen-new.pdf 612.8 kB
  • PDF/pics.pdf 376.6 kB
  • PDF/pictionary-sentences.pdf 11.0 kB
  • PDF/picture-story-last-saturday.pdf 226.3 kB
  • PDF/picture_and_writing_page.pdf 68.0 kB
  • PDF/pictures_cards.pdf 1.1 MB
  • PDF/pingus_hatsprepositions.pdf 296.7 kB
  • PDF/pingus_hatsprepositions_001.pdf 296.7 kB
  • PDF/pinigigholidayboardgame.pdf 1.9 MB
  • PDF/pinigigphoneticchartvowels.pdf 317.0 kB
  • PDF/place-of-adverbs.pdf 393.9 kB
  • PDF/Places vocabulary.pdf 212.3 kB
  • PDF/places-adj.pdf 652.4 kB
  • PDF/places-dice.pdf 166.6 kB
  • PDF/places-directions.pdf 95.4 kB
  • PDF/places_of_worship.pdf 61.1 kB
  • PDF/placesaroundtown.pdf 1.6 MB
  • PDF/plan-a-party-speaking-activity.pdf 102.2 kB
  • PDF/plan.pdf 1.3 MB
  • PDF/plane.pdf 223.9 kB
  • PDF/planning-writing.pdf 51.9 kB
  • PDF/plant-corn.pdf 173.2 kB
  • PDF/PLANTS PUZZLE.pdf 218.1 kB
  • PDF/plastic-surgery.pdf 33.7 kB
  • PDF/playgameswithenglish1.pdf 137.8 kB
  • PDF/playgameswithenglish1_001.pdf 96.8 kB
  • PDF/playgameswithenglish1_002.pdf 81.0 kB
  • PDF/playgameswithenglish1_003.pdf 88.6 kB
  • PDF/playgameswithenglish1_004.pdf 92.4 kB
  • PDF/playgameswithenglish1_005.pdf 107.0 kB
  • PDF/playgameswithenglish1_006.pdf 101.6 kB
  • PDF/playgameswithenglish1_007.pdf 110.2 kB
  • PDF/playgameswithenglish1_008.pdf 98.3 kB
  • PDF/playgameswithenglish1_009.pdf 103.8 kB
  • PDF/playgameswithenglish1_010.pdf 89.4 kB
  • PDF/playgameswithenglish1_011.pdf 112.7 kB
  • PDF/playgameswithenglish1_012.pdf 109.6 kB
  • PDF/playgameswithenglish1_013.pdf 82.8 kB
  • PDF/playgameswithenglish1_014.pdf 89.8 kB
  • PDF/playgameswithenglish1_015.pdf 126.7 kB
  • PDF/playgameswithenglish1_016.pdf 112.7 kB
  • PDF/playgameswithenglish1_017.pdf 102.9 kB
  • PDF/playgameswithenglish1_018.pdf 95.7 kB
  • PDF/playgameswithenglish1_019.pdf 111.0 kB
  • PDF/playgameswithenglish1_020.pdf 105.8 kB
  • PDF/playgameswithenglish1_021.pdf 76.0 kB
  • PDF/playgameswithenglish1_022.pdf 95.8 kB
  • PDF/playgameswithenglish1_023.pdf 135.9 kB
  • PDF/playgameswithenglish1_024.pdf 109.1 kB
  • PDF/playgameswithenglish1_025.pdf 136.2 kB
  • PDF/playgameswithenglish1_026.pdf 100.2 kB
  • PDF/playgameswithenglish1_027.pdf 121.1 kB
  • PDF/playgameswithenglish1_028.pdf 141.5 kB
  • PDF/playgameswithenglish1_029.pdf 124.7 kB
  • PDF/playgameswithenglish1_030.pdf 100.5 kB
  • PDF/playgameswithenglish1_031.pdf 120.7 kB
  • PDF/playgameswithenglish1_032.pdf 106.2 kB
  • PDF/playgameswithenglish1_033.pdf 93.1 kB
  • PDF/playgameswithenglish1_034.pdf 113.8 kB
  • PDF/playgameswithenglish1_035.pdf 108.1 kB
  • PDF/playgameswithenglish1_036.pdf 96.8 kB
  • PDF/playgameswithenglish1_037.pdf 131.3 kB
  • PDF/playgameswithenglish1_038.pdf 131.5 kB
  • PDF/playgameswithenglish1_039.pdf 137.8 kB
  • PDF/playgameswithenglish1_040.pdf 96.8 kB
  • PDF/playgameswithenglish1_041.pdf 81.0 kB
  • PDF/playgameswithenglish1_042.pdf 88.6 kB
  • PDF/playgameswithenglish1_043.pdf 92.4 kB
  • PDF/playgameswithenglish1_044.pdf 107.0 kB
  • PDF/playgameswithenglish1_045.pdf 101.6 kB
  • PDF/playgameswithenglish1_046.pdf 110.2 kB
  • PDF/playgameswithenglish1_047.pdf 98.3 kB
  • PDF/playgameswithenglish1_048.pdf 103.8 kB
  • PDF/playgameswithenglish1_049.pdf 89.4 kB
  • PDF/playgameswithenglish1_050.pdf 112.7 kB
  • PDF/playgameswithenglish1_051.pdf 109.6 kB
  • PDF/playgameswithenglish1_052.pdf 82.8 kB
  • PDF/playgameswithenglish1_053.pdf 89.8 kB
  • PDF/playgameswithenglish1_054.pdf 126.7 kB
  • PDF/playgameswithenglish1_055.pdf 112.7 kB
  • PDF/playgameswithenglish1_056.pdf 102.9 kB
  • PDF/playgameswithenglish1_057.pdf 95.7 kB
  • PDF/playgameswithenglish1_058.pdf 111.0 kB
  • PDF/playgameswithenglish1_059.pdf 105.8 kB
  • PDF/playgameswithenglish1_060.pdf 76.0 kB
  • PDF/playgameswithenglish1_061.pdf 95.8 kB
  • PDF/playgameswithenglish1_062.pdf 135.9 kB
  • PDF/playgameswithenglish1_063.pdf 109.1 kB
  • PDF/playgameswithenglish1_064.pdf 136.2 kB
  • PDF/playgameswithenglish1_065.pdf 100.2 kB
  • PDF/playgameswithenglish1_066.pdf 121.1 kB
  • PDF/playgameswithenglish1_067.pdf 141.5 kB
  • PDF/playgameswithenglish1_068.pdf 124.7 kB
  • PDF/playgameswithenglish1_069.pdf 100.5 kB
  • PDF/playgameswithenglish1_070.pdf 120.7 kB
  • PDF/playgameswithenglish1_071.pdf 106.2 kB
  • PDF/playgameswithenglish1_072.pdf 93.1 kB
  • PDF/playgameswithenglish1_073.pdf 113.8 kB
  • PDF/playgameswithenglish1_074.pdf 108.1 kB
  • PDF/playgameswithenglish1_075.pdf 96.8 kB
  • PDF/playgameswithenglish1_076.pdf 131.3 kB
  • PDF/playgameswithenglish1_077.pdf 131.5 kB
  • PDF/playing-cards-lesson.pdf 1.0 MB
  • PDF/plral-of-nouns-2012.pdf 392.7 kB
  • PDF/plrals-game.pdf 356.1 kB
  • PDF/plural-of-nouns-lesson-with-sound.pdf 1.2 MB
  • PDF/plurals-easy.pdf 64.5 kB
  • PDF/plurals.pdf 64.5 kB
  • PDF/plurals1.pdf 260.6 kB
  • PDF/plurals_001.pdf 64.5 kB
  • PDF/poem-a-bad-case-of-the-sneezes-past-simple-gap.pdf 115.7 kB
  • PDF/polite-requests-totalenglish.pdf 53.5 kB
  • PDF/pony.pdf 1.6 MB
  • PDF/pop_songs-in-class-article.pdf 15.5 kB
  • PDF/pos-newspaper.pdf 73.9 kB
  • PDF/pose-a-question-to.pdf 1.0 MB
  • PDF/possessive-adjectives-2012.pdf 140.9 kB
  • PDF/possessive-adjectives.pdf 23.7 kB
  • PDF/possessive-determiners.pdf 246.8 kB
  • PDF/possessive-pronouns.pdf 29.0 kB
  • PDF/possessives-worksheet.pdf 119.0 kB
  • PDF/possessives.pdf 87.9 kB
  • PDF/postcard-mad-lib.pdf 382.9 kB
  • PDF/poster-christmas.pdf 298.9 kB
  • PDF/poster.pdf 255.0 kB
  • PDF/potaddition.pdf 72.4 kB
  • PDF/potato-latkies.pdf 1.4 MB
  • PDF/potion.pdf 153.8 kB
  • PDF/power-point-family-the-simpsons.pdf 1.3 MB
  • PDF/power_project1.pdf 1.0 MB
  • PDF/power_project2.pdf 503.5 kB
  • PDF/ppc-star-guessing-game.pdf 40.3 kB
  • PDF/ppt-circus.pdf 841.2 kB
  • PDF/ppt-circus_001.pdf 841.2 kB
  • PDF/ppt-presentatie.pdf 594.1 kB
  • PDF/pr-simple-sweet-but-horrible.pdf 189.5 kB
  • PDF/pr_cont_simple.pdf 763.5 kB
  • PDF/practica-2-ex-2-tri.pdf 90.8 kB
  • PDF/practical_expressions.pdf 404.7 kB
  • PDF/practice-adjectives-and-adverbs.pdf 58.0 kB
  • PDF/practice-nationalities-and-verb-to-be.pdf 282.5 kB
  • PDF/praisers.pdf 3.5 MB
  • PDF/pre-sim.pdf 212.6 kB
  • PDF/predlogi-voprosy-20.pdf 17.9 kB
  • PDF/prefer.pdf 89.8 kB
  • PDF/prefix-multiple-choice-b-2.pdf 180.4 kB
  • PDF/Prefixes in im.pdf 214.2 kB
  • PDF/prefixes-and-suffixes.pdf 1.4 MB
  • PDF/prefixes-intelligent-business-revision.pdf 83.8 kB
  • PDF/prefixes.pdf 113.2 kB
  • PDF/prep-of-place-1.pdf 226.6 kB
  • PDF/prep-of-place.pdf 118.1 kB
  • PDF/prep.pdf 559.1 kB
  • PDF/prep_quiz.pdf 56.8 kB
  • PDF/prepos_of_time.pdf 13.9 kB
  • PDF/prepos_of_time_001.pdf 13.9 kB
  • PDF/preposition-in-on-at-place-and-time.pdf 77.1 kB
  • PDF/preposition-power-place.pdf 739.8 kB
  • PDF/preposition-quiz.pdf 67.2 kB
  • PDF/preposition_memory_game.pdf 93.1 kB
  • PDF/prepositional-verbs-10th-form.pdf 67.0 kB
  • PDF/prepositional-verbs.pdf 275.1 kB
  • PDF/prepositions-2-between-under-next-to.pdf 171.0 kB
  • PDF/prepositions-2.pdf 332.1 kB
  • PDF/prepositions-between-under-next-to.pdf 15.5 kB
  • PDF/prepositions-boardgame.pdf 1.1 MB
  • PDF/prepositions-exercise.pdf 54.0 kB
  • PDF/prepositions-following-adjectives.pdf 268.7 kB
  • PDF/prepositions-intermediate-2012.pdf 107.9 kB
  • PDF/prepositions-july2012.pdf 233.2 kB
  • PDF/prepositions-match.pdf 345.2 kB
  • PDF/prepositions-moving-house.pdf 321.4 kB
  • PDF/prepositions-of-movement-2011.pdf 535.3 kB
  • PDF/prepositions-of-place-flashcards-monkey.pdf 459.2 kB
  • PDF/prepositions-of-place-my-room.pdf 261.6 kB
  • PDF/prepositions-of-place.pdf 280.5 kB
  • PDF/prepositions-of-time-2012.pdf 116.4 kB
  • PDF/prepositions-of-time-at-on-in.pdf 35.8 kB
  • PDF/prepositions-of-time-dec.pdf 319.8 kB
  • PDF/prepositions-of-time-mini-book.pdf 453.5 kB
  • PDF/prepositions-of-time-place-and-movement.pdf 209.1 kB
  • PDF/prepositions-pic.pdf 59.9 kB
  • PDF/prepositions-with-verbs.pdf 229.0 kB
  • PDF/prepositions.pdf 626.8 kB
  • PDF/prepositions2.pdf 222.5 kB
  • PDF/prepositions_001.pdf 37.8 kB
  • PDF/prepositions_002.pdf 126.8 kB
  • PDF/prepositions_003.pdf 580.5 kB
  • PDF/prepositions_004.pdf 69.2 kB
  • PDF/prepositions_005.pdf 71.9 kB
  • PDF/prepositions_006.pdf 295.0 kB
  • PDF/prepositions_007.pdf 103.3 kB
  • PDF/prepositions_008.pdf 71.3 kB
  • PDF/prepositions_009.pdf 274.7 kB
  • PDF/prepositions_game.pdf 99.6 kB
  • PDF/prepositions_game_001.pdf 99.6 kB
  • PDF/prepositions_of_time1.pdf 89.1 kB
  • PDF/prepositions_of_time1_001.pdf 89.1 kB
  • PDF/prepositions_of_time2.pdf 90.6 kB
  • PDF/prepositions_of_time2_001.pdf 90.6 kB
  • PDF/prepositions_ofplace1.pdf 84.0 kB
  • PDF/prepositions_ofplace1_001.pdf 84.0 kB
  • PDF/prepositionsoftime.pdf 325.3 kB
  • PDF/prepositionwitch.pdf 824.9 kB
  • PDF/preps-of-place.pdf 1.0 MB
  • PDF/preps_of_time_bus.pdf 40.4 kB
  • PDF/preps_of_time_bus_001.pdf 40.4 kB
  • PDF/preschooler_bookmark.pdf 3.3 MB
  • PDF/preschoolerscoloringsheet.pdf 720.7 kB
  • PDF/Present Continuous Word Search.pdf 220.9 kB
  • PDF/present-and-past-habits.pdf 66.3 kB
  • PDF/present-cont-compar-superlative-errors.pdf 29.3 kB
  • PDF/present-continous-2012.pdf 135.2 kB
  • PDF/present-continuos-worksheet.pdf 1.1 MB
  • PDF/present-continuous-and-present-simple-for-the.pdf 346.6 kB
  • PDF/present-continuous-board-game.pdf 2.2 MB
  • PDF/present-continuous-conversation-cards.pdf 1.6 MB
  • PDF/present-continuous-english.pdf 3.5 MB
  • PDF/present-continuous-exercises.pdf 847.7 kB
  • PDF/present-continuous-explanation.pdf 416.6 kB
  • PDF/present-continuous-for-description.pdf 323.2 kB
  • PDF/present-continuous-future-arrangements.pdf 368.0 kB
  • PDF/present-continuous-iii.pdf 203.1 kB
  • PDF/present-continuous-test.pdf 357.4 kB
  • PDF/present-continuous-test_001.pdf 367.8 kB
  • PDF/present-continuous.pdf 3.5 MB
  • PDF/present-continuous_-ana.pdf 751.4 kB
  • PDF/present-continuous_001.pdf 568.5 kB
  • PDF/present-continuous_002.pdf 502.0 kB
  • PDF/present-past-passive.pdf 13.1 kB
  • PDF/present-past-simple-continuous.pdf 89.1 kB
  • PDF/present-past.pdf 175.8 kB
  • PDF/present-perfect-2012.pdf 99.4 kB
  • PDF/present-perfect-continuous.pdf 1.2 MB
  • PDF/present-perfect-exercise-1.pdf 29.9 kB
  • PDF/present-perfect-london.pdf 1.6 MB
  • PDF/present-perfect-past-simple-used-to.pdf 222.7 kB
  • PDF/present-perfect-past-simple_-ana.pdf 122.6 kB
  • PDF/present-perfect-simple-2.pdf 369.3 kB
  • PDF/present-perfect-simple-or-past-simple1.pdf 44.1 kB
  • PDF/present-perfect-tense.pdf 397.3 kB
  • PDF/present-perfect-vs-past-simple.pdf 368.5 kB
  • PDF/present-perfect-vs-simple-past.pdf 530.6 kB
  • PDF/present-perfect-well-explained.pdf 504.0 kB
  • PDF/present-perfect-x-simple-past.pdf 80.1 kB
  • PDF/present-perfect.pdf 163.7 kB
  • PDF/present-perfect_groundhog-day_video-task.pdf 316.5 kB
  • PDF/present-practice-and-telling-time.pdf 13.3 kB
  • PDF/present-simple-63.pdf 675.7 kB
  • PDF/present-simple-a.pdf 359.5 kB
  • PDF/present-simple-and-continuous.pdf 53.8 kB
  • PDF/present-simple-and-continuous_001.pdf 129.3 kB
  • PDF/present-simple-and.pdf 51.8 kB
  • PDF/present-simple-chart.pdf 59.8 kB
  • PDF/present-simple-continuous.pdf 247.1 kB
  • PDF/present-simple-continuous_001.pdf 213.2 kB
  • PDF/present-simple-daily-routines.pdf 169.9 kB
  • PDF/present-simple-english.pdf 4.8 MB
  • PDF/present-simple-exercises-intermediate.pdf 89.1 kB
  • PDF/present-simple-exercises.pdf 340.8 kB
  • PDF/present-simple-explanation.pdf 411.8 kB
  • PDF/present-simple-flow-chart.pdf 72.3 kB
  • PDF/present-simple-iii.pdf 259.7 kB
  • PDF/present-simple-iii_001.pdf 444.8 kB
  • PDF/present-simple-negative.pdf 754.9 kB
  • PDF/present-simple-or-continuous-gap-filling-key.pdf 457.0 kB
  • PDF/present-simple-powerpoint-presentation.pdf 278.0 kB
  • PDF/present-simple-practice.pdf 102.1 kB
  • PDF/present-simple-questions-flashcards.pdf 26.1 kB
  • PDF/present-simple-questions-game.pdf 54.8 kB
  • PDF/present-simple-tense.pdf 217.7 kB
  • PDF/present-simple-versus-present-continuous.pdf 264.1 kB
  • PDF/present-simple-vs-present-continuous-acabar.pdf 130.2 kB
  • PDF/present-simple-vs-present-continuous-chart.pdf 29.6 kB
  • PDF/present-simple-vs-present-continuous.pdf 327.0 kB
  • PDF/present-simple-vs-present-continuous_001.pdf 104.1 kB
  • PDF/present-simple-vs-present-continuous_002.pdf 97.6 kB
  • PDF/present-simple-worksheet.pdf 51.2 kB
  • PDF/present-simple-x-present-progressive.pdf 195.2 kB
  • PDF/present-simple.pdf 4.8 MB
  • PDF/present-simple_001.pdf 104.1 kB
  • PDF/present-simple_002.pdf 312.9 kB
  • PDF/present-simple_003.pdf 30.0 kB
  • PDF/present-simple_004.pdf 219.1 kB
  • PDF/present-simple_005.pdf 269.3 kB
  • PDF/present-simple_006.pdf 438.9 kB
  • PDF/present-simple_007.pdf 139.5 kB
  • PDF/present-simple_008.pdf 231.5 kB
  • PDF/present-simple_009.pdf 385.7 kB
  • PDF/present-tenses-2003.pdf 198.2 kB
  • PDF/present-tenses-general.pdf 36.7 kB
  • PDF/present_perfect_continuous_activity.pdf 563.6 kB
  • PDF/present_perfect_continuous_activity_001.pdf 563.6 kB
  • PDF/present_perfect_past_tense.pdf 32.7 kB
  • PDF/present_progressive_fools_garden_lemon_tree.pdf 38.8 kB
  • PDF/present_simple_routine_game.pdf 16.5 kB
  • PDF/presentaci243n1.pdf 120.3 kB
  • PDF/presentation-on-writing.pdf 895.3 kB
  • PDF/presentation-party-lesson.pdf 1.4 MB
  • PDF/presentation-practice.pdf 350.4 kB
  • PDF/presentations.pdf 36.8 kB
  • PDF/presentperfectlessonplan_part_1.pdf 77.1 kB
  • PDF/presentsimpletense.pdf 118.4 kB
  • PDF/preserving-our-planet.pdf 116.2 kB
  • PDF/president.pdf 131.8 kB
  • PDF/price-dictation-ws21-2.pdf 26.2 kB
  • PDF/price-tag.pdf 191.5 kB
  • PDF/pride-prejudice-student-version.pdf 60.8 kB
  • PDF/prince-of-persia-2.pdf 95.0 kB
  • PDF/printable-taboo-game.pdf 106.4 kB
  • PDF/printables_place_cards.pdf 234.3 kB
  • PDF/priscilla-ahn-dream.pdf 300.1 kB
  • PDF/problem-cards-2003.pdf 61.7 kB
  • PDF/problem-solving.pdf 31.2 kB
  • PDF/product_disaster.pdf 168.6 kB
  • PDF/Professions and occupations.pdf 212.2 kB
  • PDF/professions.pdf 207.2 kB
  • PDF/professions_001.pdf 207.2 kB
  • PDF/professions_002.pdf 1.5 MB
  • PDF/profile-page_lesson-1.pdf 242.0 kB
  • PDF/proj-worksheet1ver.pdf 85.0 kB
  • PDF/proj-worksheet2ver.pdf 53.6 kB
  • PDF/proj-worksheet3ver.pdf 62.8 kB
  • PDF/proj-worksheet4ver.pdf 109.0 kB
  • PDF/proj-worksheet5ver.pdf 43.2 kB
  • PDF/project-management-explained-simply.pdf 113.2 kB
  • PDF/project.pdf 202.7 kB
  • PDF/pronoun-review.pdf 31.5 kB
  • PDF/Pronouns.pdf 220.0 kB
  • PDF/pronouns_001.pdf 146.2 kB
  • PDF/pronun.pdf 29.9 kB
  • PDF/pronunciation-cards-97.pdf 446.7 kB
  • PDF/pronunciation-of-numbers.pdf 19.0 kB
  • PDF/pronunciationpracticew.pdf 26.8 kB
  • PDF/pros-and-cons.pdf 27.5 kB
  • PDF/prostitution.pdf 66.9 kB
  • PDF/proud.pdf 235.7 kB
  • PDF/Proverb Tile Puzzle houses.pdf 214.5 kB
  • PDF/Proverbs Tile Puzzle.pdf 215.1 kB
  • PDF/Proverbs Tile Puzzle_001.pdf 214.8 kB
  • PDF/Proverbs Tile Puzzle_002.pdf 214.1 kB
  • PDF/Proverbs Tile Puzzle_003.pdf 214.4 kB
  • PDF/Proverbs Tile Puzzle_004.pdf 215.6 kB
  • PDF/Proverbs Tile Puzzle_005.pdf 215.6 kB
  • PDF/Proverbs Tile Puzzle_006.pdf 213.8 kB
  • PDF/Proverbs Tile Puzzle_007.pdf 214.9 kB
  • PDF/Proverbs Tile Puzzle_008.pdf 215.3 kB
  • PDF/Proverbs Tile Puzzle_009.pdf 215.1 kB
  • PDF/Proverbs Tile Puzzle_010.pdf 214.9 kB
  • PDF/Proverbs Tile Puzzle_011.pdf 215.1 kB
  • PDF/Proverbs Tile Puzzle_012.pdf 214.3 kB
  • PDF/Proverbs Tile Puzzle_013.pdf 214.6 kB
  • PDF/Proverbs Tile Puzzle_014.pdf 215.8 kB
  • PDF/proverbs.pdf 38.5 kB
  • PDF/prueba.pdf 345.4 kB
  • PDF/ps-pcontinuous.pdf 206.5 kB
  • PDF/ps-vs-pc.pdf 174.3 kB
  • PDF/psimple-vs-pcontinuous.pdf 447.9 kB
  • PDF/public-speaking.pdf 1.8 MB
  • PDF/pumpkin.pdf 206.2 kB
  • PDF/punctuation-cards.pdf 464.5 kB
  • PDF/punctuation-matters.pdf 1.7 MB
  • PDF/punctuation-poster.pdf 626.2 kB
  • PDF/purpose-clauses.pdf 84.5 kB
  • PDF/puzzle-game.pdf 217.7 kB
  • PDF/puzzle-homes-and-houses-e1.pdf 220.0 kB
  • PDF/puzzlesprielem.pdf 3.6 MB
  • PDF/qtags.pdf 32.8 kB
  • PDF/qtopix2.pdf 301.1 kB
  • PDF/qu1.pdf 249.6 kB
  • PDF/quan.pdf 16.2 kB
  • PDF/quantifiers-1.pdf 243.8 kB
  • PDF/quantifiers-board-game.pdf 588.8 kB
  • PDF/quantifiers-too-many-too-much-enough-too.pdf 582.4 kB
  • PDF/queen-show-must-go-on.pdf 53.7 kB
  • PDF/Question Words.pdf 207.5 kB
  • PDF/question-cards.pdf 36.4 kB
  • PDF/question-tags-1.pdf 103.6 kB
  • PDF/question-tags-intermediate.pdf 378.8 kB
  • PDF/question-tags.pdf 102.6 kB
  • PDF/question-word.pdf 74.0 kB
  • PDF/question-words-2012-1.pdf 171.2 kB
  • PDF/question-words.pdf 594.6 kB
  • PDF/question-words3.pdf 174.5 kB
  • PDF/question.pdf 334.8 kB
  • PDF/question_words.pdf 31.7 kB
  • PDF/questions-2012.pdf 461.0 kB
  • PDF/questions-and-answers.pdf 150.8 kB
  • PDF/questions-and-answers_001.pdf 21.7 kB
  • PDF/questions-daily-routine.pdf 202.8 kB
  • PDF/questions.pdf 201.9 kB
  • PDF/questions_-29-november.pdf 504.3 kB
  • PDF/questions_001.pdf 622.9 kB
  • PDF/questions_002.pdf 16.1 kB
  • PDF/questions_003.pdf 19.3 kB
  • PDF/questions_004.pdf 16.1 kB
  • PDF/questiontags.pdf 89.7 kB
  • PDF/questiontags1.pdf 85.1 kB
  • PDF/questiontags1_001.pdf 85.1 kB
  • PDF/questiontags2.pdf 86.2 kB
  • PDF/questiontags2_001.pdf 86.2 kB
  • PDF/questiontags3.pdf 85.1 kB
  • PDF/questiontags3_001.pdf 85.1 kB
  • PDF/questiontags4.pdf 85.3 kB
  • PDF/questiontags4_001.pdf 85.3 kB
  • PDF/questiontags5.pdf 86.4 kB
  • PDF/questiontags5_001.pdf 86.4 kB
  • PDF/questiontags6.pdf 84.2 kB
  • PDF/questiontags6_001.pdf 84.2 kB
  • PDF/questiontags7.pdf 86.6 kB
  • PDF/questiontags7_001.pdf 86.6 kB
  • PDF/questiontags8.pdf 85.6 kB
  • PDF/questiontags8_001.pdf 85.6 kB
  • PDF/quick_reference_guide.pdf 288.9 kB
  • PDF/quiz-a.pdf 42.5 kB
  • PDF/quiz-emotions.pdf 387.2 kB
  • PDF/quiz-t1.pdf 31.5 kB
  • PDF/quotes-poster.pdf 247.8 kB
  • PDF/ra-bellthat-1.pdf 249.1 kB
  • PDF/rachael-yamagata-i-dont-want-to-be-your-mother.pdf 18.7 kB
  • PDF/rachel-and-phoebe-literature-class.pdf 45.4 kB
  • PDF/rainbow-alphabet.pdf 29.5 kB
  • PDF/rap-music-censorship.pdf 163.6 kB
  • PDF/rapunzel.pdf 99.3 kB
  • PDF/ray-kroc.pdf 10.8 kB
  • PDF/rcmp.pdf 480.2 kB
  • PDF/rdgpctwwwwwh.pdf 61.2 kB
  • PDF/read-and-compare.pdf 116.7 kB
  • PDF/read-and-draw.pdf 48.7 kB
  • PDF/read-and-solve-the-biograpy-puzzle-ex.pdf 102.4 kB
  • PDF/read-each-sentence-then-circle-the-correct-verb.pdf 36.4 kB
  • PDF/read-match-actions.pdf 469.1 kB
  • PDF/read-the-text-below-and-think-of-the-word-which.pdf 222.9 kB
  • PDF/readerstheater-a-mothers-surprise.pdf 119.3 kB
  • PDF/Reading Week Elementary Word Search.pdf 212.3 kB
  • PDF/reading-about-pluto-four-skills.pdf 111.6 kB
  • PDF/reading-activity-bed-bugs.pdf 181.7 kB
  • PDF/reading-activity-dog-causes-fire.pdf 251.4 kB
  • PDF/reading-activity-firing.pdf 216.0 kB
  • PDF/reading-activity-texting.pdf 210.6 kB
  • PDF/reading-ads.pdf 322.1 kB
  • PDF/reading-and-grammar-past-tense-review.pdf 121.1 kB
  • PDF/reading-comprehension-1.pdf 106.9 kB
  • PDF/reading-comprehension-about-self-confidence.pdf 318.6 kB
  • PDF/reading-comprehension-chocolate-for-all-occasions.pdf 284.8 kB
  • PDF/reading-comprehension-family-describing-people.pdf 335.3 kB
  • PDF/reading-comprehension-music-7th.pdf 150.3 kB
  • PDF/reading-comprehension-selfesteem8th.pdf 44.9 kB
  • PDF/reading-comprehension.pdf 324.1 kB
  • PDF/reading-comprehension_001.pdf 41.5 kB
  • PDF/reading-comprehension_the_maryrose.pdf 372.2 kB
  • PDF/reading-did-you-know-10-neil-armstrong.pdf 71.8 kB
  • PDF/reading-did-you-know-11-pope-benedict-xvi.pdf 60.3 kB
  • PDF/reading-did-you-know-6-michael-phelps.pdf 98.3 kB
  • PDF/reading-did-you-know-7-usain-bolt.pdf 102.5 kB
  • PDF/reading-did-you-know-8-kate-middleton.pdf 72.2 kB
  • PDF/reading-did-you-know-9-oscar-pistorius.pdf 88.7 kB
  • PDF/reading-did-you-know-curiosity.pdf 64.3 kB
  • PDF/reading-did-you-know-moon-trip.pdf 98.2 kB
  • PDF/reading-did-you-know-stinky-flower.pdf 70.0 kB
  • PDF/reading-did-you-know-texting-champion.pdf 82.6 kB
  • PDF/reading-did-you-now-toronto.pdf 77.9 kB
  • PDF/reading-gb.pdf 78.0 kB
  • PDF/reading-names.pdf 192.2 kB
  • PDF/reading-practice.pdf 47.8 kB
  • PDF/reading-strange-night.pdf 210.1 kB
  • PDF/reading-tasks.pdf 50.9 kB
  • PDF/reading-usa-elections-2012.pdf 158.9 kB
  • PDF/reading-voc-obesityhealthfat-food.pdf 128.4 kB
  • PDF/reading.pdf 458.3 kB
  • PDF/reading_001.pdf 441.6 kB
  • PDF/reading_agriculture_what-to-do-about-lead.pdf 205.2 kB
  • PDF/ready-set-prepare-a-disaster-preparedness.pdf 3.0 MB
  • PDF/recipe-caramel-shortcakes-students.pdf 70.8 kB
  • PDF/recipe.pdf 665.0 kB
  • PDF/recipes.pdf 151.9 kB
  • PDF/recipes_001.pdf 246.0 kB
  • PDF/regular-past-tense-worksheet.pdf 52.4 kB
  • PDF/regular-verbs-spelling-rules.pdf 558.5 kB
  • PDF/regular-verbs1.pdf 876.7 kB
  • PDF/regular-verbsii.pdf 282.1 kB
  • PDF/rehab.pdf 18.5 kB
  • PDF/relationships.pdf 15.9 kB
  • PDF/relationships_001.pdf 342.1 kB
  • PDF/relative-clauses-test-1.pdf 208.6 kB
  • PDF/relative-clauses-test-2.pdf 247.7 kB
  • PDF/relative-clauses-test-3.pdf 187.9 kB
  • PDF/relative-clauses.pdf 461.8 kB
  • PDF/relative-clauses_001.pdf 85.7 kB
  • PDF/relative-pronouns.pdf 61.5 kB
  • PDF/relative_clauses.pdf 218.3 kB
  • PDF/Relatives.pdf 212.2 kB
  • PDF/relativos-agosto.pdf 24.8 kB
  • PDF/remember.pdf 418.0 kB
  • PDF/repeat.pdf 150.8 kB
  • PDF/rephrasing-modals.pdf 21.4 kB
  • PDF/reported-practice.pdf 209.3 kB
  • PDF/reported-speech-1.pdf 142.2 kB
  • PDF/reported-speech-1_001.pdf 82.3 kB
  • PDF/reported-speech-2.pdf 512.5 kB
  • PDF/reported-speech-2_001.pdf 52.3 kB
  • PDF/reported-speech-3.pdf 323.4 kB
  • PDF/reported-speech-and-classics.pdf 123.3 kB
  • PDF/reported-speech-dec2012.pdf 88.3 kB
  • PDF/reported-speech-exercises.pdf 718.2 kB
  • PDF/reported-speech-iii.pdf 127.8 kB
  • PDF/reported-speech-present.pdf 58.1 kB
  • PDF/reported-speech-questions.pdf 106.3 kB
  • PDF/reported-speech.pdf 1.1 MB
  • PDF/reported-speech1.pdf 23.2 kB
  • PDF/reported-speech2.pdf 26.9 kB
  • PDF/reported-speech3.pdf 54.0 kB
  • PDF/reported-speech3_001.pdf 22.7 kB
  • PDF/reported-speech_001.pdf 77.4 kB
  • PDF/reported-speech_002.pdf 119.0 kB
  • PDF/reported-speech_003.pdf 70.0 kB
  • PDF/reported-speech_004.pdf 553.6 kB
  • PDF/reporting-verbs-crossword.pdf 45.2 kB
  • PDF/reporting-verbs.pdf 228.6 kB
  • PDF/reporting_change.pdf 85.8 kB
  • PDF/requests.pdf 17.6 kB
  • PDF/resident-evil-4-afterlife.pdf 69.5 kB
  • PDF/rest-2.pdf 328.2 kB
  • PDF/restaurant_role_cards.pdf 22.6 kB
  • PDF/retelling.pdf 29.7 kB
  • PDF/review-and-kiss-with-a-fist.pdf 79.7 kB
  • PDF/review-exercises-basic-level.pdf 34.0 kB
  • PDF/review-mid-ld2.pdf 113.2 kB
  • PDF/review-nl.pdf 108.1 kB
  • PDF/revision-domino.pdf 686.7 kB
  • PDF/revision-final-test.pdf 364.5 kB
  • PDF/revision-for-class-8-future.pdf 53.1 kB
  • PDF/revision-game-b.pdf 272.1 kB
  • PDF/revision-jumbled-sentences.pdf 26.9 kB
  • PDF/revision-of-tenses-10-form.pdf 72.1 kB
  • PDF/revision-presentpast-simple-continuous-adjectives.pdf 264.9 kB
  • PDF/revision-questions.pdf 25.4 kB
  • PDF/revision-time.pdf 631.7 kB
  • PDF/revision-tree-tops-3-practice-2-feb-2012.pdf 341.8 kB
  • PDF/revision-worksheet-tutorial-gingerbread-man.pdf 756.9 kB
  • PDF/revision.pdf 14.6 kB
  • PDF/revision_001.pdf 282.6 kB
  • PDF/rew_uppint_a_life_in_the_day_of.pdf 135.7 kB
  • PDF/rew_uppint_a_life_in_the_day_of_001.pdf 135.7 kB
  • PDF/rew_uppint_advertising_campaign.pdf 169.0 kB
  • PDF/rew_uppint_advertising_campaign_001.pdf 169.0 kB
  • PDF/rew_uppint_alphabet_game.pdf 211.5 kB
  • PDF/rew_uppint_alphabet_game_001.pdf 211.5 kB
  • PDF/rew_uppint_anythings_possible.pdf 133.6 kB
  • PDF/rew_uppint_anythings_possible_001.pdf 133.6 kB
  • PDF/rew_uppint_are_you_experienced.pdf 100.8 kB
  • PDF/rew_uppint_are_you_experienced_001.pdf 100.8 kB
  • PDF/rew_uppint_brainstorm.pdf 106.1 kB
  • PDF/rew_uppint_brainstorm_001.pdf 106.1 kB
  • PDF/rew_uppint_buy_a_sentence.pdf 112.9 kB
  • PDF/rew_uppint_buy_a_sentence_001.pdf 112.9 kB
  • PDF/rew_uppint_conditional_domonoes.pdf 105.5 kB
  • PDF/rew_uppint_conditional_domonoes_001.pdf 105.5 kB
  • PDF/rew_uppint_descriptions.pdf 153.6 kB
  • PDF/rew_uppint_descriptions_001.pdf 153.6 kB
  • PDF/rew_uppint_dont_say_it.pdf 198.6 kB
  • PDF/rew_uppint_dont_say_it_001.pdf 198.6 kB
  • PDF/rew_uppint_drawing_game.pdf 146.1 kB
  • PDF/rew_uppint_drawing_game_001.pdf 146.1 kB
  • PDF/rew_uppint_dream_destinations.pdf 168.0 kB
  • PDF/rew_uppint_dream_destinations_001.pdf 168.0 kB
  • PDF/rew_uppint_encounters_of_a_spooky_kind.pdf 101.1 kB
  • PDF/rew_uppint_encounters_of_a_spooky_kind_001.pdf 101.1 kB
  • PDF/rew_uppint_facts_and_myths.pdf 118.5 kB
  • PDF/rew_uppint_facts_and_myths_001.pdf 118.5 kB
  • PDF/rew_uppint_family_matters.pdf 157.4 kB
  • PDF/rew_uppint_family_matters_001.pdf 157.4 kB
  • PDF/rew_uppint_find_someone_who.pdf 145.6 kB
  • PDF/rew_uppint_find_someone_who_001.pdf 145.6 kB
  • PDF/rew_uppint_get_a_line.pdf 267.2 kB
  • PDF/rew_uppint_get_a_line_001.pdf 267.2 kB
  • PDF/rew_uppint_give_me_a_clue.pdf 245.7 kB
  • PDF/rew_uppint_give_me_a_clue_001.pdf 245.7 kB
  • PDF/rew_uppint_hows_your_haggling.pdf 122.8 kB
  • PDF/rew_uppint_hows_your_haggling_001.pdf 122.8 kB
  • PDF/rew_uppint_i_know_you_dont_i.pdf 123.2 kB
  • PDF/rew_uppint_i_know_you_dont_i_001.pdf 123.2 kB
  • PDF/rew_uppint_i_was_going_to_but.pdf 169.7 kB
  • PDF/rew_uppint_i_was_going_to_but_001.pdf 169.7 kB
  • PDF/rew_uppint_impossible.pdf 200.3 kB
  • PDF/rew_uppint_impossible_001.pdf 200.3 kB
  • PDF/rew_uppint_it_made_my_day.pdf 108.9 kB
  • PDF/rew_uppint_it_made_my_day_001.pdf 108.9 kB
  • PDF/rew_uppint_landscapes.pdf 155.6 kB
  • PDF/rew_uppint_landscapes_001.pdf 155.6 kB
  • PDF/rew_uppint_life_would_have_been_different.pdf 127.5 kB
  • PDF/rew_uppint_life_would_have_been_different_001.pdf 127.5 kB
  • PDF/rew_uppint_lifestyle_profiles.pdf 199.6 kB
  • PDF/rew_uppint_lifestyle_profiles_001.pdf 199.6 kB
  • PDF/rew_uppint_look_back.pdf 154.0 kB
  • PDF/rew_uppint_look_back_001.pdf 154.0 kB
  • PDF/rew_uppint_men_and_women_are_from_different_planets.pdf 124.2 kB
  • PDF/rew_uppint_men_and_women_are_from_different_planets_001.pdf 124.2 kB
  • PDF/rew_uppint_my_kind_of_people.pdf 122.9 kB
  • PDF/rew_uppint_my_kind_of_people_001.pdf 122.9 kB
  • PDF/rew_uppint_permission_to_lie.pdf 108.7 kB
  • PDF/rew_uppint_permission_to_lie_001.pdf 108.7 kB
  • PDF/rew_uppint_school_days.pdf 99.6 kB
  • PDF/rew_uppint_school_days_001.pdf 99.6 kB
  • PDF/rew_uppint_snakes_and_ladders.pdf 129.0 kB
  • PDF/rew_uppint_snakes_and_ladders_001.pdf 129.0 kB
  • PDF/rew_uppint_something_strange_happened_on_the_way_to.pdf 89.6 kB
  • PDF/rew_uppint_something_strange_happened_on_the_way_to_001.pdf 89.6 kB
  • PDF/rew_uppint_spend_spend_spend.pdf 151.1 kB
  • PDF/rew_uppint_spend_spend_spend_001.pdf 151.1 kB
  • PDF/rew_uppint_ten_years_from_now.pdf 76.7 kB
  • PDF/rew_uppint_ten_years_from_now_001.pdf 76.7 kB
  • PDF/rew_uppint_the_grass_is_always_greener.pdf 105.1 kB
  • PDF/rew_uppint_the_grass_is_always_greener_001.pdf 105.1 kB
  • PDF/rew_uppint_things_to_do_places_to_visit.pdf 187.1 kB
  • PDF/rew_uppint_things_to_do_places_to_visit_001.pdf 187.1 kB
  • PDF/rew_uppint_tomorrows_world.pdf 179.5 kB
  • PDF/rew_uppint_tomorrows_world_001.pdf 179.5 kB
  • PDF/rew_uppint_useful_objects_crossword.pdf 226.3 kB
  • PDF/rew_uppint_useful_objects_crossword_001.pdf 226.3 kB
  • PDF/rew_uppint_what_have_we_got_in_common.pdf 108.1 kB
  • PDF/rew_uppint_what_have_we_got_in_common_001.pdf 108.1 kB
  • PDF/rew_uppint_what_have_you_been_up_to.pdf 127.9 kB
  • PDF/rew_uppint_what_have_you_been_up_to_001.pdf 127.9 kB
  • PDF/rew_uppint_what_is_it.pdf 217.5 kB
  • PDF/rew_uppint_what_is_it_001.pdf 217.5 kB
  • PDF/rew_uppint_when_we_were_ten.pdf 125.8 kB
  • PDF/rew_uppint_when_we_were_ten_001.pdf 125.8 kB
  • PDF/rew_uppint_whose_life_is_it.pdf 102.2 kB
  • PDF/rew_uppint_whose_life_is_it_001.pdf 102.2 kB
  • PDF/rew_uppint_your_views_on_technology.pdf 137.4 kB
  • PDF/rew_uppint_your_views_on_technology_001.pdf 137.4 kB
  • PDF/ricky-s-wish.pdf 276.8 kB
  • PDF/riddles-guess-the-fruit-or-vegetable.pdf 176.5 kB
  • PDF/riddles.pdf 62.7 kB
  • PDF/right-or-wrong-be-or-have.pdf 9.5 kB
  • PDF/rihana_california-king-bed_body-parts_black-and.pdf 124.9 kB
  • PDF/rimes-word-families-assessment.pdf 177.4 kB
  • PDF/ritish-english.pdf 463.8 kB
  • PDF/rme_beglowin_trust_me.pdf 106.6 kB
  • PDF/rme_beglowin_trust_me_001.pdf 106.6 kB
  • PDF/rme_beglowint_artists.pdf 100.3 kB
  • PDF/rme_beglowint_artists_001.pdf 100.3 kB
  • PDF/robbery.pdf 190.5 kB
  • PDF/robbery_001.pdf 26.9 kB
  • PDF/robert-palmer.pdf 41.7 kB
  • PDF/robin-hood-test.pdf 39.3 kB
  • PDF/robot-invasion-1.pdf 445.1 kB
  • PDF/rod-stewart-sailing-lyrics.pdf 41.8 kB
  • PDF/role-play-complaint.pdf 35.7 kB
  • PDF/role-play-famous-people.pdf 202.8 kB
  • PDF/rolemodeltipsheet.pdf 377.6 kB
  • PDF/roleplaying.pdf 58.6 kB
  • PDF/roleplays_sample.pdf 264.6 kB
  • PDF/rolling-in-the-deep-adele.pdf 106.5 kB
  • PDF/rolling.pdf 106.0 kB
  • PDF/rome-wasnt-built-in-a-day.pdf 448.2 kB
  • PDF/rome.pdf 186.7 kB
  • PDF/rooms-in-the-house-crossword.pdf 368.5 kB
  • PDF/rooms-in-the-house-kitchen.pdf 361.7 kB
  • PDF/rooms-in-the-house-living-room.pdf 269.1 kB
  • PDF/rooms.pdf 213.5 kB
  • PDF/roswell-reading.pdf 341.1 kB
  • PDF/routinematch-true-or-false.pdf 107.8 kB
  • PDF/routines.pdf 126.6 kB
  • PDF/routines_001.pdf 21.4 kB
  • PDF/rowan-atkinsons-biography.pdf 232.7 kB
  • PDF/rules-for-adding-suffixes-to-root-words.pdf 72.9 kB
  • PDF/rules-for-adjective-endings.pdf 180.1 kB
  • PDF/rules.pdf 144.2 kB
  • PDF/rules_001.pdf 303.8 kB
  • PDF/rumours1.pdf 402.1 kB
  • PDF/runaway-bride.pdf 219.3 kB
  • PDF/rundown.pdf 79.4 kB
  • PDF/Rural landscapes - Word Search.pdf 207.6 kB
  • PDF/s-and-z-words.pdf 110.8 kB
  • PDF/s-h-e-w-o-l-f-by-shakira.pdf 116.5 kB
  • PDF/s-valentine.pdf 87.7 kB
  • PDF/s.pdf 47.0 kB
  • PDF/s2.pdf 119.0 kB
  • PDF/s233ance-luka.pdf 688.7 kB
  • PDF/sad.pdf 222.4 kB
  • PDF/safe-and-sound-taylor-swift.pdf 204.9 kB
  • PDF/SAFETY AND HAZARDS.pdf 220.4 kB
  • PDF/safety-equipment.pdf 50.8 kB
  • PDF/saint-patrick-flashcards-1.pdf 3.4 MB
  • PDF/saint-patricks-day.pdf 469.4 kB
  • PDF/saint-valentines-day-arts-and-crafts.pdf 1.6 MB
  • PDF/samuel1-places-around-town2.pdf 314.8 kB
  • PDF/san-fermin-1.pdf 60.1 kB
  • PDF/santa-claus-is-coming-to-town-hl.pdf 47.6 kB
  • PDF/santa-maria.pdf 643.6 kB
  • PDF/santa.pdf 259.4 kB
  • PDF/satellitek_reva2.pdf 1.7 MB
  • PDF/save-the-world.pdf 378.9 kB
  • PDF/save-the-world_001.pdf 55.0 kB
  • PDF/say-it-again.pdf 280.2 kB
  • PDF/say-tell-talk-speak.pdf 121.4 kB
  • PDF/scared.pdf 199.3 kB
  • PDF/scavenger-hunt.pdf 232.1 kB
  • PDF/school elementary word search.pdf 218.3 kB
  • PDF/School objects.pdf 217.9 kB
  • PDF/school things.pdf 215.9 kB
  • PDF/school-bus-rules.pdf 51.9 kB
  • PDF/school-objects.pdf 790.8 kB
  • PDF/school-rules-poster.pdf 58.2 kB
  • PDF/school-shooting-in-newtown-term.pdf 125.2 kB
  • PDF/school-subjects-word-search.pdf 220.2 kB
  • PDF/school-subjects.pdf 456.0 kB
  • PDF/school-subjects_001.pdf 33.4 kB
  • PDF/school-supplies.pdf 465.6 kB
  • PDF/school-supplies_001.pdf 230.6 kB
  • PDF/school-supplies_002.pdf 814.0 kB
  • PDF/school-timetable.pdf 146.6 kB
  • PDF/school.pdf 211.9 kB
  • PDF/school_001.pdf 158.5 kB
  • PDF/science-and-discoveries.pdf 215.1 kB
  • PDF/scott_pilgrim_x_world.pdf 227.2 kB
  • PDF/scrabble-game.pdf 3.9 MB
  • PDF/scrabble-phonics-upload.pdf 125.5 kB
  • PDF/scrambled-olympic-sports.pdf 55.6 kB
  • PDF/sdandrovocimplangpres.pdf 45.6 kB
  • PDF/se7en.pdf 35.0 kB
  • PDF/sea-creatures.pdf 462.3 kB
  • PDF/sea_animals.pdf 151.9 kB
  • PDF/seal-english.pdf 1.4 MB
  • PDF/seaside-tourism-wordsearch.pdf 63.4 kB
  • PDF/season.pdf 170.5 kB
  • PDF/seasons-activity.pdf 277.6 kB
  • PDF/seasons-wheel.pdf 1.4 MB
  • PDF/seasons.pdf 226.0 kB
  • PDF/seasons_001.pdf 1.5 MB
  • PDF/seasons_002.pdf 1.3 MB
  • PDF/seasonsclassroomposter.pdf 247.0 kB
  • PDF/second-conditional-2.pdf 22.4 kB
  • PDF/second-conditional-2012.pdf 66.9 kB
  • PDF/second-conditional.pdf 22.5 kB
  • PDF/secondconditional.pdf 223.1 kB
  • PDF/secret-of-the-wings-tinker-bell.pdf 489.3 kB
  • PDF/secrets-of-a-happy-marriage.pdf 55.0 kB
  • PDF/secrets-to-a-happy-marriage.pdf 57.8 kB
  • PDF/secrets.pdf 57.7 kB
  • PDF/selena-gomez-who-says-reported-speech.pdf 142.5 kB
  • PDF/self-access-learning-material-for-efl-learners.pdf 2.3 MB
  • PDF/self-assessment-sheet.pdf 97.1 kB
  • PDF/selling-skills-roleplay-1.pdf 26.2 kB
  • PDF/sensible-sentences-game.pdf 724.0 kB
  • PDF/sentence-building.pdf 21.3 kB
  • PDF/sentence-order-in-english.pdf 2.2 MB
  • PDF/sentence-structure-exercise-001_bt.pdf 65.6 kB
  • PDF/sentence-transformation-1.pdf 31.7 kB
  • PDF/sentence-transformation-present-perfect-past.pdf 13.7 kB
  • PDF/sentence.pdf 27.6 kB
  • PDF/sentenceformation.pdf 400.0 kB
  • PDF/sentenceformation_001.pdf 400.0 kB
  • PDF/sep.pdf 280.7 kB
  • PDF/sep10329.pdf 272.0 kB
  • PDF/sept-holidays.pdf 230.3 kB
  • PDF/september-poem.pdf 96.0 kB
  • PDF/september-writing-template.pdf 164.3 kB
  • PDF/set-fire-to-the-rain-preparar-atividade.pdf 415.6 kB
  • PDF/set-fire-to-the-rain.pdf 185.7 kB
  • PDF/set-fire-to-the-rain_001.pdf 348.6 kB
  • PDF/set1_matching.pdf 181.3 kB
  • PDF/Severe Weather Word Search.pdf 212.1 kB
  • PDF/Sewing Terms.pdf 220.4 kB
  • PDF/shake-it-out.pdf 83.7 kB
  • PDF/shake-up-christmas.pdf 46.5 kB
  • PDF/shakira.pdf 3.0 MB
  • PDF/shape-name-matching-h.pdf 41.3 kB
  • PDF/shape.pdf 173.6 kB
  • PDF/shapebook_stpatricksday2.pdf 32.3 kB
  • PDF/SHAPES AND COLORS.pdf 218.2 kB
  • PDF/shapes-and-colors.pdf 411.4 kB
  • PDF/shapes.pdf 216.1 kB
  • PDF/she-is-my-mother.pdf 139.2 kB
  • PDF/she-loves-you.pdf 179.3 kB
  • PDF/sheikh-mohammed-poems.pdf 501.9 kB
  • PDF/sheldon-cooper-2.pdf 137.1 kB
  • PDF/shine-bright-like-a-diamond.pdf 42.5 kB
  • PDF/shinedown-simple-man-students.pdf 618.6 kB
  • PDF/shopping-game.pdf 325.5 kB
  • PDF/shopping-pictures-and-prices.pdf 85.8 kB
  • PDF/shopping-situations.pdf 38.0 kB
  • PDF/shopping-video-activity.pdf 48.0 kB
  • PDF/shopping-wordsearch-1.pdf 217.9 kB
  • PDF/shopping.pdf 62.7 kB
  • PDF/shopping_001.pdf 248.4 kB
  • PDF/shopping_002.pdf 13.3 kB
  • PDF/short-answers.pdf 55.2 kB
  • PDF/short-answers2.pdf 29.1 kB
  • PDF/short-film-past-tense.pdf 65.9 kB
  • PDF/short-story.pdf 150.2 kB
  • PDF/short-straw.pdf 456.1 kB
  • PDF/should-shouldent.pdf 418.0 kB
  • PDF/should.pdf 1.3 MB
  • PDF/SICKNESS.pdf 217.7 kB
  • PDF/sight-syllables-assessment.pdf 187.2 kB
  • PDF/silent-letters.pdf 1.9 MB
  • PDF/similes.pdf 73.0 kB
  • PDF/simple present.pdf 210.1 kB
  • PDF/simple-past-and-past-continuous-tenses.pdf 65.7 kB
  • PDF/simple-past-class-sheet.pdf 1.1 MB
  • PDF/simple-past-game-new.pdf 1.5 MB
  • PDF/simple-past-iii.pdf 527.8 kB
  • PDF/simple-past-simple-present.pdf 359.5 kB
  • PDF/simple-past-tense-ec-club-msw.pdf 94.4 kB
  • PDF/simple-past-tense-vs-past-continuous.pdf 57.9 kB
  • PDF/simple-past-vs-present-perfect.pdf 95.9 kB
  • PDF/simple-past.pdf 46.4 kB
  • PDF/simple-past_001.pdf 624.4 kB
  • PDF/simple-past_002.pdf 114.7 kB
  • PDF/simple-pres-vs-pres-cont.pdf 36.7 kB
  • PDF/simple-present-3c.pdf 105.2 kB
  • PDF/simple-present-and-present-continuous-olympics.pdf 63.4 kB
  • PDF/simple-present-he-she_journey-to-the-center.pdf 423.2 kB
  • PDF/simple-present-tense-sentenses.pdf 209.2 kB
  • PDF/simple-present-tense-workshop.pdf 20.1 kB
  • PDF/simple-present-vs-present-progressive.pdf 528.6 kB
  • PDF/simple-present.pdf 30.1 kB
  • PDF/simple-present_001.pdf 65.2 kB
  • PDF/simple-present_002.pdf 220.4 kB
  • PDF/simple-present_003.pdf 72.9 kB
  • PDF/simple-tenses.pdf 47.4 kB
  • PDF/simple-vocabulary-test-verbs.pdf 170.6 kB
  • PDF/simpsons-family-tree-complete-gaps.pdf 220.3 kB
  • PDF/simpsons-peresent-cont.pdf 203.0 kB
  • PDF/simpsons.pdf 102.4 kB
  • PDF/simpsons_001.pdf 775.8 kB
  • PDF/singular-plural.pdf 86.6 kB
  • PDF/situations.pdf 26.6 kB
  • PDF/skaterboy_possessive.pdf 46.6 kB
  • PDF/skazka-o-sobakax.pdf 32.3 kB
  • PDF/skin-by-roald-dahl-test.pdf 81.4 kB
  • PDF/skyfall-by-adele.pdf 164.6 kB
  • PDF/skyfall-lyrics.pdf 66.0 kB
  • PDF/skyfall.pdf 172.6 kB
  • PDF/slangs.pdf 243.2 kB
  • PDF/slavery-ex-esl-printables.pdf 466.9 kB
  • PDF/sleep.pdf 140.0 kB
  • PDF/slidesword-doc.pdf 28.6 kB
  • PDF/slovesa_neprav15prav15.pdf 13.3 kB
  • PDF/small-animals1-words.pdf 201.9 kB
  • PDF/small-animals2-words.pdf 270.7 kB
  • PDF/small-talk-and-icebreakers.pdf 894.9 kB
  • PDF/smash.pdf 186.3 kB
  • PDF/smell.pdf 206.8 kB
  • PDF/smoking-vocabulary-exercise.pdf 23.3 kB
  • PDF/SMOKING.pdf 218.3 kB
  • PDF/snakes-and-ladders-irregular-verbs.pdf 410.1 kB
  • PDF/snakes-and-ladders-passive-voice.pdf 201.0 kB
  • PDF/snakes-and-laders.pdf 194.8 kB
  • PDF/snakesladders-spielbrett.pdf 223.0 kB
  • PDF/snoopy-halloween.pdf 2.5 MB
  • PDF/snow-ball-fight.pdf 461.1 kB
  • PDF/snow-white-and-the-huntsman-trailer-word-search.pdf 219.8 kB
  • PDF/snr3unit8.pdf 293.5 kB
  • PDF/so-far-away.pdf 67.3 kB
  • PDF/so-what-listening.pdf 202.3 kB
  • PDF/social-media-simi.pdf 370.1 kB
  • PDF/social-networking-word-search.pdf 220.4 kB
  • PDF/social-networks.pdf 25.2 kB
  • PDF/social_letters.pdf 139.6 kB
  • PDF/some-any-no.pdf 81.3 kB
  • PDF/some-music-oct-2012.pdf 509.4 kB
  • PDF/some-nights-fun.pdf 56.3 kB
  • PDF/some-rules-of-gerunds-and-infinitives.pdf 99.3 kB
  • PDF/somebody-i-used-to-know-lyrics.pdf 41.1 kB
  • PDF/somebody-that-i-used-to-know-timeline-story.pdf 249.4 kB
  • PDF/someone-like-you-worksheet-by-adele.pdf 49.3 kB
  • PDF/something-about-the-sunshine.pdf 484.0 kB
  • PDF/somewhere-over-the-rainbow-exercise.pdf 190.3 kB
  • PDF/song-activity-angie-the-rolling-stones.pdf 97.4 kB
  • PDF/song-activity-bi.pdf 259.7 kB
  • PDF/song-activity-destinys-child-survivor.pdf 91.1 kB
  • PDF/song-by-b-marley-war-mp-esl.pdf 256.6 kB
  • PDF/song-by-u2.pdf 62.1 kB
  • PDF/song-class-the-lazy-song-worksheet-and.pdf 76.9 kB
  • PDF/song-daddy-worksheet.pdf 49.8 kB
  • PDF/song-im-yours.pdf 66.4 kB
  • PDF/song-jealous-guy.pdf 394.7 kB
  • PDF/song-la-isla-bonita-by-madonna.pdf 243.9 kB
  • PDF/song-listening-comprehension-pink-just-give-me-a.pdf 142.7 kB
  • PDF/song-lyrics-count-on-me.pdf 524.3 kB
  • PDF/song-mother-john-lennon-past-tense-level-beginner.pdf 52.0 kB
  • PDF/song-stand-by-me-.pdf 75.0 kB
  • PDF/song-winds-of-change.pdf 181.9 kB
  • PDF/song-worksheet-feel-by-robbie-williams.pdf 131.6 kB
  • PDF/song-worksheet-leave-out-all-the-rest.pdf 23.9 kB
  • PDF/song-worksheet-present-perfect-girl-like-you.pdf 47.4 kB
  • PDF/song-worksheet-the-blues-brothers.pdf 207.4 kB
  • PDF/song.pdf 215.3 kB
  • PDF/songs-to-study-english-2-short.pdf 5.0 MB
  • PDF/songs.pdf 1.1 MB
  • PDF/songtoreviewprepositionsandphrasalverbs.pdf 38.4 kB
  • PDF/songworksheet-the-cure-lovesong.pdf 251.1 kB
  • PDF/sorting-out-animals.pdf 2.1 MB
  • PDF/Space Word search.pdf 214.1 kB
  • PDF/space-pics-vocab-elementary.pdf 1.2 MB
  • PDF/space.pdf 429.6 kB
  • PDF/spain_goya_awards.pdf 133.2 kB
  • PDF/spanglish-film-viewing_busy-teacher.pdf 340.8 kB
  • PDF/spanish-elections.pdf 499.7 kB
  • PDF/speaking-activity-4.pdf 1.0 MB
  • PDF/speaking-activity-learning-english.pdf 245.2 kB
  • PDF/speaking-activity.pdf 20.5 kB
  • PDF/speaking-activity_modal-auxiliary-verbs.pdf 57.6 kB
  • PDF/speaking-board-game.pdf 300.4 kB
  • PDF/speaking-yes-no-answers-whats-is-this.pdf 1.4 MB
  • PDF/special-buildings-burj-khalifa.pdf 57.6 kB
  • PDF/spelling-game.pdf 363.1 kB
  • PDF/spelling-mnemonics-busyteacher.pdf 248.5 kB
  • PDF/spelling-snakes-and-ladders.pdf 137.6 kB
  • PDF/spk-family-1.pdf 151.7 kB
  • PDF/spk-hobbies.pdf 118.9 kB
  • PDF/splitconversationamericanenglishfile11c.pdf 222.4 kB
  • PDF/Sport itermediate word search.pdf 216.4 kB
  • PDF/Sports elementary wordsearch.pdf 216.4 kB
  • PDF/sports word search.pdf 212.4 kB
  • PDF/sports-2.pdf 436.2 kB
  • PDF/sports-2012.pdf 465.6 kB
  • PDF/sports-2012_001.pdf 814.1 kB
  • PDF/sports-animals-flash.pdf 1.6 MB
  • PDF/sports-can-likes-and-dislikes.pdf 51.3 kB
  • PDF/sports-crossword-2012.pdf 274.4 kB
  • PDF/sports-game-2011.pdf 909.7 kB
  • PDF/sports-missing.pdf 662.1 kB
  • PDF/sports-poster-2012.pdf 575.8 kB
  • PDF/SPORTS.pdf 217.9 kB
  • PDF/sports_001.pdf 386.8 kB
  • PDF/sports_002.pdf 32.7 kB
  • PDF/spot.pdf 39.8 kB
  • PDF/spotkania.pdf 22.5 kB
  • PDF/spotting-lies.pdf 15.6 kB
  • PDF/Spring is in the air.pdf 212.8 kB
  • PDF/spring vocabulary.pdf 216.2 kB
  • PDF/spring-dancing-flowers.pdf 85.7 kB
  • PDF/spring-poems.pdf 881.4 kB
  • PDF/spring-vocabulary.pdf 357.4 kB
  • PDF/Spring.pdf 211.8 kB
  • PDF/spring_001.pdf 99.3 kB
  • PDF/springtime-activities.pdf 99.5 kB
  • PDF/springtime-bingo.pdf 252.0 kB
  • PDF/springtime-mobile.pdf 65.2 kB
  • PDF/sptr2.pdf 56.9 kB
  • PDF/ss-mce-e.pdf 230.0 kB
  • PDF/St Patricks Day.pdf 212.3 kB
  • PDF/St Patricks Wordsearch.pdf 212.1 kB
  • PDF/st-david-beginner-reading-worksheet.pdf 78.1 kB
  • PDF/st-nicholas-day.pdf 1.1 MB
  • PDF/st-patr-abc.pdf 39.7 kB
  • PDF/st-patrick-flash.pdf 838.1 kB
  • PDF/st-patricks-mini.pdf 374.5 kB
  • PDF/st-patricks-poster.pdf 904.2 kB
  • PDF/st-patricks-sayings.pdf 124.5 kB
  • PDF/st-patricks-worksheet1.pdf 746.1 kB
  • PDF/St. Patricks Day Word Search.pdf 210.4 kB
  • PDF/St.Patricks Day Elementary Word Search.pdf 203.7 kB
  • PDF/stairway_to_heaven.pdf 97.2 kB
  • PDF/stand-by-me-activity.pdf 15.4 kB
  • PDF/standup-shamrocks.pdf 77.9 kB
  • PDF/star-times.pdf 219.1 kB
  • PDF/starbucks-ceo-schultz-talks-past.pdf 525.2 kB
  • PDF/state-vs-action.pdf 1.1 MB
  • PDF/Stating Opinions Elementary Word Search.pdf 217.9 kB
  • PDF/Stative Verbs.pdf 220.2 kB
  • PDF/stative.pdf 415.3 kB
  • PDF/stay-with-you-by-john-legend.pdf 64.3 kB
  • PDF/step-by-step-103-part-1.pdf 485.6 kB
  • PDF/stepeni-sravneniya.pdf 570.7 kB
  • PDF/stereotypes.pdf 423.4 kB
  • PDF/stickers_val07.pdf 598.0 kB
  • PDF/sticky.pdf 1.0 MB
  • PDF/sting-fields-of-gold.pdf 63.9 kB
  • PDF/sting.pdf 52.6 kB
  • PDF/stoplite.pdf 111.1 kB
  • PDF/stories.pdf 1.1 MB
  • PDF/story-of-us-listening-mar.pdf 173.5 kB
  • PDF/story.pdf 34.3 kB
  • PDF/story_001.pdf 187.5 kB
  • PDF/storytelling.pdf 275.7 kB
  • PDF/stpatricksdaypowerpoint.pdf 6.2 MB
  • PDF/strange-food-around-the-world.pdf 1.2 MB
  • PDF/stranger-by-the-day-corrected.pdf 50.8 kB
  • PDF/student-birthdays.pdf 143.7 kB
  • PDF/student-crossword.pdf 95.1 kB
  • PDF/student-have-got.pdf 284.1 kB
  • PDF/student-home-work-worksheet-number-names-term-1.pdf 32.6 kB
  • PDF/student-id-card.pdf 121.3 kB
  • PDF/student_info_survey.pdf 118.3 kB
  • PDF/student_snapshot.pdf 96.5 kB
  • PDF/students-complete-the-funny-faces.pdf 48.6 kB
  • PDF/stuff_and_things.pdf 69.5 kB
  • PDF/stuffing_meter.pdf 130.8 kB
  • PDF/subcultures-items.pdf 6.0 MB
  • PDF/subject-matters-for-the-debates-and-oral-exams.pdf 65.5 kB
  • PDF/subject-object-questions.pdf 771.2 kB
  • PDF/subject-possessive-saxon-key.pdf 71.6 kB
  • PDF/subject-pronouns.pdf 150.3 kB
  • PDF/subject_object_pronouns.pdf 44.5 kB
  • PDF/substitute-teacher-information-sheet.pdf 75.9 kB
  • PDF/suffix-definition-sort.pdf 218.4 kB
  • PDF/Summer Break from School.pdf 209.1 kB
  • PDF/summer-2012.pdf 650.5 kB
  • PDF/summer-activities.pdf 54.6 kB
  • PDF/summer-at-the-sea-side.pdf 379.0 kB
  • PDF/summer-bulletin-boards.pdf 594.9 kB
  • PDF/summer-cards-2012.pdf 941.3 kB
  • PDF/summer-clipart.pdf 176.7 kB
  • PDF/summer-decoding.pdf 497.8 kB
  • PDF/summer-flashcards.pdf 858.3 kB
  • PDF/summer-fun-picture-dictionary.pdf 710.0 kB
  • PDF/summer-game.pdf 571.7 kB
  • PDF/summer-jobs-for-kids.pdf 85.8 kB
  • PDF/summer-journal.pdf 35.3 kB
  • PDF/summer-of-69.pdf 191.8 kB
  • PDF/summer-paradise.pdf 461.9 kB
  • PDF/summer-schoo-test-types-of-sentences.pdf 209.3 kB
  • PDF/summer-wine-snap.pdf 278.5 kB
  • PDF/summer-wodsearch.pdf 389.1 kB
  • PDF/summer.pdf 377.2 kB
  • PDF/sunglasses.pdf 33.6 kB
  • PDF/sunlight-by-the-4-of-us.pdf 65.1 kB
  • PDF/super_word_racer.pdf 292.7 kB
  • PDF/superhero.pdf 212.9 kB
  • PDF/superlative-speaking-cards.pdf 108.7 kB
  • PDF/superlative-worksheet.pdf 221.2 kB
  • PDF/superlative_jeopardy-1.pdf 158.1 kB
  • PDF/supermarket-ad_info-gap.pdf 493.1 kB
  • PDF/supersizeme-worksheet-axs-2012.pdf 190.1 kB
  • PDF/supplies-classroom-flashcards.pdf 996.7 kB
  • PDF/surprise.pdf 236.8 kB
  • PDF/survey.pdf 57.6 kB
  • PDF/survey_about_school_subjects.pdf 61.0 kB
  • PDF/survey_about_school_subjects_001.pdf 61.0 kB
  • PDF/survive-stress.pdf 245.9 kB
  • PDF/sva-analysis-whole.pdf 141.0 kB
  • PDF/sweatshops-child-labour.pdf 188.4 kB
  • PDF/swicthfoot-your-love-is-a-song-present-cont.pdf 54.1 kB
  • PDF/symbols.pdf 121.0 kB
  • PDF/synonym-and-antonym-worksheet.pdf 40.8 kB
  • PDF/szitu-pic.pdf 380.4 kB
  • PDF/t-o-u-c-h.pdf 291.1 kB
  • PDF/t-shirt.pdf 99.9 kB
  • PDF/taboo-game-02.pdf 47.5 kB
  • PDF/taboo-game-03.pdf 63.5 kB
  • PDF/tag-questions-time-race.pdf 101.5 kB
  • PDF/tag-questions.pdf 114.8 kB
  • PDF/tag-questions1.pdf 141.1 kB
  • PDF/talk-for-a-minute.pdf 1.1 MB
  • PDF/talking-about-abilities-in-english.pdf 553.6 kB
  • PDF/talking-about-events-in-the-past.pdf 107.4 kB
  • PDF/talking-about-feelings.pdf 44.6 kB
  • PDF/talking-about-what-people-are-doing-present.pdf 685.1 kB
  • PDF/taller-1.pdf 51.4 kB
  • PDF/tangled-activities.pdf 350.8 kB
  • PDF/tarot.pdf 483.8 kB
  • PDF/task1.pdf 85.8 kB
  • PDF/taste_match.pdf 21.8 kB
  • PDF/tattoo-art-reading-comprehension.pdf 245.5 kB
  • PDF/taxing-marijuana-in-california.pdf 208.1 kB
  • PDF/taylor-swiff-song.pdf 167.1 kB
  • PDF/tb1back-to-school.pdf 485.4 kB
  • PDF/tbbt-video-session-the-frienship-algorithm.pdf 299.1 kB
  • PDF/tea.pdf 167.2 kB
  • PDF/teachers_form.pdf 179.8 kB
  • PDF/teacherspage.pdf 26.4 kB
  • PDF/teaching-esl-students-about-the-12-days-of.pdf 22.6 kB
  • PDF/teaching-may-i-vs.pdf 118.6 kB
  • PDF/tech_voc.pdf 262.8 kB
  • PDF/technology-sms.pdf 50.9 kB
  • PDF/Technology.pdf 210.2 kB
  • PDF/Technology_001.pdf 214.8 kB
  • PDF/ted-talk-try-something-new-for-30-days.pdf 194.3 kB
  • PDF/ted-talk-worksheet.pdf 51.6 kB
  • PDF/ted-talks.pdf 25.3 kB
  • PDF/ted_jay-walker.pdf 92.5 kB
  • PDF/ted_richard_stjohn.pdf 81.3 kB
  • PDF/ted_stacey_kramer.pdf 85.9 kB
  • PDF/teddy-bear.pdf 533.0 kB
  • PDF/teen-stars-love-dogs-bt.pdf 338.8 kB
  • PDF/teens.pdf 543.0 kB
  • PDF/teens_marijuana_brochure.pdf 373.6 kB
  • PDF/telepathy.pdf 26.6 kB
  • PDF/telephone-roleplays.pdf 44.0 kB
  • PDF/telephoning-song-listening-pre.pdf 97.2 kB
  • PDF/Television Double Puzzle.pdf 214.5 kB
  • PDF/television.pdf 219.7 kB
  • PDF/tell-me-about-your-last-vacation.pdf 46.4 kB
  • PDF/tell-me-why.pdf 331.6 kB
  • PDF/tell-the-truth-tell-a-lie.pdf 26.7 kB
  • PDF/telling-the-time.pdf 169.5 kB
  • PDF/telling-time-flash-cards.pdf 1.9 MB
  • PDF/telling-time.pdf 524.5 kB
  • PDF/tener.pdf 37.2 kB
  • PDF/tense-blender.pdf 200.1 kB
  • PDF/tense-cheat-sheet.pdf 71.0 kB
  • PDF/tense-revision.pdf 42.8 kB
  • PDF/tense_rw_find_someone_who.pdf 124.4 kB
  • PDF/tense_rw_find_someone_who_001.pdf 124.4 kB
  • PDF/tenses-letter.pdf 1.5 MB
  • PDF/tenses.pdf 24.4 kB
  • PDF/tenses_001.pdf 157.5 kB
  • PDF/tenses_all-of-them.pdf 234.2 kB
  • PDF/tenses_table.pdf 82.8 kB
  • PDF/tenses_table_001.pdf 53.0 kB
  • PDF/test-1.pdf 148.2 kB
  • PDF/test-body.pdf 444.8 kB
  • PDF/test-dlya-fizikov-1-2.pdf 364.8 kB
  • PDF/test-for-b1-tues.pdf 156.5 kB
  • PDF/test-for-halloween.pdf 45.5 kB
  • PDF/test-of-irregular-verbs.pdf 31.2 kB
  • PDF/test-on-quantifiers.pdf 84.0 kB
  • PDF/test-that-determines-the-level-of-the-student.pdf 44.2 kB
  • PDF/test-your-simple-past-tense.pdf 67.7 kB
  • PDF/test.pdf 141.9 kB
  • PDF/test_001.pdf 112.6 kB
  • PDF/test_002.pdf 55.9 kB
  • PDF/test_003.pdf 138.8 kB
  • PDF/test_your_english.pdf 136.2 kB
  • PDF/teste-de-6.pdf 325.0 kB
  • PDF/teste10186-nov-key.pdf 184.6 kB
  • PDF/text-review.pdf 85.4 kB
  • PDF/text2mindmap_family_members.pdf 152.8 kB
  • PDF/thanks-giving-ii.pdf 276.7 kB
  • PDF/thanks-mini.pdf 223.3 kB
  • PDF/thanks.pdf 222.5 kB
  • PDF/thanksgiving-border.pdf 251.1 kB
  • PDF/thanksgiving-characters-2.pdf 253.9 kB
  • PDF/thanksgiving-characters.pdf 315.4 kB
  • PDF/thanksgiving-november.pdf 592.1 kB
  • PDF/thanksgiving-tale-reader.pdf 1.3 MB
  • PDF/thanksgiving.pdf 393.8 kB
  • PDF/thanksgiving_001.pdf 393.8 kB
  • PDF/thanksgiving_002.pdf 79.2 kB
  • PDF/thanksgiving_003.pdf 152.8 kB
  • PDF/thanksgiving_leftovers.pdf 160.3 kB
  • PDF/thanksgiving_placecards.pdf 223.1 kB
  • PDF/thankyoufor.pdf 318.9 kB
  • PDF/that-must-be-have-to-dont-have-to-activities.pdf 21.8 kB
  • PDF/thats-gr8.pdf 37.0 kB
  • PDF/thats-my-village-key.pdf 359.4 kB
  • PDF/The Body.pdf 220.9 kB
  • PDF/The body_001.pdf 220.3 kB
  • PDF/THE ENVIRONMENT.pdf 217.7 kB
  • PDF/The Environment_001.pdf 217.8 kB
  • PDF/The Environment_002.pdf 220.1 kB
  • PDF/The place we live in.pdf 212.1 kB
  • PDF/THE POWER OF NATURE.pdf 212.1 kB
  • PDF/the press.pdf 220.3 kB
  • PDF/The Shopping Centre.pdf 220.2 kB
  • PDF/the-abc-song.pdf 55.6 kB
  • PDF/the-adventures-of-perseus_fill-in.pdf 536.8 kB
  • PDF/the-alphabet-.pdf 65.6 kB
  • PDF/the-alphabet-song.pdf 98.9 kB
  • PDF/the-alphabet.pdf 894.5 kB
  • PDF/the-american-dream.pdf 36.4 kB
  • PDF/the-argumentative-essay-blank-student-outline.pdf 196.0 kB
  • PDF/the-art-teacher.pdf 153.2 kB
  • PDF/the-beauty-of-zen.pdf 199.7 kB
  • PDF/the-bedroom.pdf 483.2 kB
  • PDF/the-bedroom_001.pdf 149.6 kB
  • PDF/the-best-holiday-of-my-life.pdf 390.3 kB
  • PDF/the-big-bang-theory-activity-s3-e15.pdf 223.8 kB
  • PDF/the-big-bang-theory-s1e1.pdf 227.7 kB
  • PDF/the-blind-side-activities-keys.pdf 314.7 kB
  • PDF/the-blind-side-movie-useful-worksheet.pdf 205.5 kB
  • PDF/the-boy-who-cried-wolf.pdf 518.6 kB
  • PDF/the-brainstorming-game.pdf 193.7 kB
  • PDF/the-canterville-ghost.pdf 234.2 kB
  • PDF/the-climb-miley-cyrus.pdf 217.6 kB
  • PDF/the-clown-is-jumping.pdf 2.2 MB
  • PDF/the-clown.pdf 201.8 kB
  • PDF/the-comparative-with-modifiers.pdf 117.2 kB
  • PDF/the-coolest-sport-ever.pdf 34.6 kB
  • PDF/the-cure-friday-beg-iii.pdf 118.2 kB
  • PDF/the-cure-lovesong.pdf 93.8 kB
  • PDF/the-curse-of-the-princess-of-amen.pdf 30.3 kB
  • PDF/the-day-the-music-died.pdf 836.8 kB
  • PDF/the-days-of-the-week.pdf 1.2 MB
  • PDF/the-definite-article.pdf 350.5 kB
  • PDF/the-double-comparative-structure.pdf 88.4 kB
  • PDF/the-dragons-pearl.pdf 3.6 MB
  • PDF/the-edpronunciationrules.pdf 42.9 kB
  • PDF/the-email2012.pdf 173.5 kB
  • PDF/the-environment-endangered-species-fauna.pdf 70.6 kB
  • PDF/the-environment-re-use-objects.pdf 5.7 MB
  • PDF/the-environment-rephrasing-key.pdf 64.7 kB
  • PDF/the-face.pdf 231.0 kB
  • PDF/the-flower-of-remembrance.pdf 146.8 kB
  • PDF/the-future-resumen.pdf 49.6 kB
  • PDF/the-gerund-mood.pdf 262.9 kB
  • PDF/the-gerund.pdf 308.9 kB
  • PDF/the-golem-of-prague.pdf 187.0 kB
  • PDF/the-great-horoscope-for-2012.pdf 911.9 kB
  • PDF/the-great-lakes-song.pdf 114.9 kB
  • PDF/the-greatest-treasure.pdf 58.2 kB
  • PDF/the-gruffalo-child-activities.pdf 797.4 kB
  • PDF/the-guinness-book-of-records.pdf 536.0 kB
  • PDF/the-history-of-valentines-day.pdf 61.9 kB
  • PDF/the-iron-lady-worksheet.pdf 528.9 kB
  • PDF/the-jellybean-creative-writing.pdf 43.0 kB
  • PDF/the-killers-mr-brightside-present-continuous-with.pdf 62.2 kB
  • PDF/the-kitchen-game-cards.pdf 4.9 MB
  • PDF/the-lake-district.pdf 139.1 kB
  • PDF/the-legend-of-nessie.pdf 85.7 kB
  • PDF/the-legend-of-the-guardians.pdf 2.4 MB
  • PDF/the-legend-original.pdf 509.4 kB
  • PDF/the-lifeboat.pdf 909.7 kB
  • PDF/the-lion-king.pdf 44.0 kB
  • PDF/the-little-fish-who-wanted-to-be-beautiful.pdf 345.2 kB
  • PDF/the-london-olympics.pdf 106.3 kB
  • PDF/the-luck-child.pdf 72.4 kB
  • PDF/the-money-pit.pdf 50.9 kB
  • PDF/the-mystery-of-the-loch-ness-monster.pdf 218.7 kB
  • PDF/the-name-of-the-raindeer.pdf 277.8 kB
  • PDF/the-night-before-christmas.pdf 336.8 kB
  • PDF/the-odd-story-of-timothy-green-movie-activity.pdf 214.2 kB
  • PDF/the-office-present-continuous.pdf 1.2 MB
  • PDF/the-old-witch-flashcards.pdf 303.9 kB
  • PDF/the-old-witch-ppp.pdf 437.8 kB
  • PDF/the-olympic-games.pdf 111.2 kB
  • PDF/the-passive-voice-with-past-continuous.pdf 107.6 kB
  • PDF/the-passive-voice-with-present-perfect.pdf 101.1 kB
  • PDF/the-past-continuousthe-past-perfect-and-the-past.pdf 53.2 kB
  • PDF/the-past-perfect-tense.pdf 1.7 MB
  • PDF/the-past-simple-negative.pdf 337.9 kB
  • PDF/the-phantom-of-the-opera-plan.pdf 314.6 kB
  • PDF/the-plural-poem.pdf 28.7 kB
  • PDF/the-polite-robber-reported-speech-powerpoint.pdf 87.7 kB
  • PDF/the-present-perfect-tense.pdf 1.5 MB
  • PDF/the-present-perfect-tense_001.pdf 265.3 kB
  • PDF/the-pretender-worksheet-verb-to-be.pdf 77.4 kB
  • PDF/the-price-is-right.pdf 507.7 kB
  • PDF/the-prince-of-persia1.pdf 105.2 kB
  • PDF/the-princess-and-the-frog.pdf 54.8 kB
  • PDF/the-princess-and-the-pea.pdf 366.7 kB
  • PDF/the-renaissance-in-britain.pdf 6.1 MB
  • PDF/the-scariest-day-of-the-year.pdf 152.7 kB
  • PDF/the-scientist-2.pdf 61.2 kB
  • PDF/the-script.pdf 132.8 kB
  • PDF/the-ship-wreck.pdf 745.4 kB
  • PDF/the-simple-present-yes-no-questions.pdf 137.2 kB
  • PDF/the-simpsons-family-tree.pdf 927.1 kB
  • PDF/the-snakes-and-the-ladders.pdf 321.1 kB
  • PDF/the-spelling-song.pdf 81.7 kB
  • PDF/the-spy-next-door-movie-worksheet.pdf 418.3 kB
  • PDF/the-story-of-rudolph-the-reindeer.pdf 382.9 kB
  • PDF/the-subjective-infinitive-construction.pdf 70.9 kB
  • PDF/the-tale-of-the-three-brothers-handout.pdf 111.5 kB
  • PDF/the-tale-of-the-three-brothers.pdf 171.5 kB
  • PDF/the-time-web.pdf 158.2 kB
  • PDF/the-tiniest-flower.pdf 1.7 MB
  • PDF/the-tower-of-london.pdf 107.5 kB
  • PDF/the-town-mouse-and-the-country-mouse.pdf 245.9 kB
  • PDF/the-tunnel.pdf 41.8 kB
  • PDF/the-twelve-tenses.pdf 9.8 kB
  • PDF/the-two-towers.pdf 30.3 kB
  • PDF/the-united-nations.pdf 50.9 kB
  • PDF/the-us-quiz.pdf 2.1 MB
  • PDF/the-usa-states.pdf 2.3 MB
  • PDF/the-v-2004.pdf 1.3 MB
  • PDF/the-verb-to-be.pdf 159.2 kB
  • PDF/the-very-hungry-caterpillar-book-ppp.pdf 490.0 kB
  • PDF/the-very-hungry-caterpillar-ppt.pdf 221.8 kB
  • PDF/the-very-hungry-caterpillar.pdf 303.7 kB
  • PDF/the-weather-dice.pdf 1.1 MB
  • PDF/the-weather.pdf 95.3 kB
  • PDF/the-winner-takes-it-all.pdf 116.0 kB
  • PDF/the_awful_fate_of_melpomenus_jones_1.pdf 59.4 kB
  • PDF/the_time.pdf 121.9 kB
  • PDF/theatre-terms-matching.pdf 48.1 kB
  • PDF/thecity.pdf 2.2 MB
  • PDF/theillusionist.pdf 134.9 kB
  • PDF/thejoke.pdf 24.4 kB
  • PDF/themanintheironmask.pdf 517.3 kB
  • PDF/therainbowfish.pdf 424.4 kB
  • PDF/there-is-there-are-pictures-with-exercises.pdf 296.4 kB
  • PDF/there-is-there-are-those-are-that-is.pdf 221.9 kB
  • PDF/there-is-there-are.pdf 46.5 kB
  • PDF/there-is.pdf 219.4 kB
  • PDF/there-to-be.pdf 91.9 kB
  • PDF/there-was-a-murder-in-the-usa.pdf 52.0 kB
  • PDF/there-was-there-were.pdf 363.7 kB
  • PDF/thexanadugame.pdf 708.1 kB
  • PDF/they-dont-get-up-late.pdf 117.5 kB
  • PDF/Things to Celebrate.pdf 220.1 kB
  • PDF/third-conditional.pdf 204.4 kB
  • PDF/third-conditional1.pdf 22.8 kB
  • PDF/this-is-2012-lyrics.pdf 109.6 kB
  • PDF/this-is-halloween.pdf 183.4 kB
  • PDF/this-is-me.pdf 215.8 kB
  • PDF/this-is-me2.pdf 381.8 kB
  • PDF/this-is-me_001.pdf 280.9 kB
  • PDF/this-pretty-face-amy-macdonald.pdf 38.3 kB
  • PDF/this-these-that-those.pdf 135.1 kB
  • PDF/this-used-to-be-my-playground-song-activity.pdf 630.4 kB
  • PDF/thoughts.pdf 235.2 kB
  • PDF/three-little-birds.pdf 97.8 kB
  • PDF/three_brothers-stepeni-sravn.pdf 188.5 kB
  • PDF/threebrownbears.pdf 213.4 kB
  • PDF/tick-the-correct-name-each-animal.pdf 364.5 kB
  • PDF/tiger.pdf 83.8 kB
  • PDF/time-2011.pdf 344.6 kB
  • PDF/time-and-place-prepositions-in-on-at.pdf 85.6 kB
  • PDF/time-clauses.pdf 521.4 kB
  • PDF/time-clauses_001.pdf 1.1 MB
  • PDF/time-dice.pdf 71.8 kB
  • PDF/time-game.pdf 261.2 kB
  • PDF/time-mini.pdf 384.3 kB
  • PDF/time-zones.pdf 734.4 kB
  • PDF/time.pdf 541.2 kB
  • PDF/time_place.pdf 160.3 kB
  • PDF/timepresentation.pdf 384.8 kB
  • PDF/timi-practice2.pdf 124.6 kB
  • PDF/tip01.pdf 77.5 kB
  • PDF/tip26.pdf 22.0 kB
  • PDF/tj5-ismks-ui.pdf 152.7 kB
  • PDF/tj5-scictt-i.pdf 109.0 kB
  • PDF/to-be-2013.pdf 248.4 kB
  • PDF/to-be-have-got-review-key.pdf 190.6 kB
  • PDF/to-be-have-got.pdf 122.8 kB
  • PDF/to-be-past-tense-affir.pdf 1.2 MB
  • PDF/to-be-verb.pdf 26.3 kB
  • PDF/to-be-worksheet.pdf 291.1 kB
  • PDF/to-be.pdf 129.5 kB
  • PDF/to-have-got.pdf 381.3 kB
  • PDF/toast.pdf 172.0 kB
  • PDF/today-is-my-day_prs-vs.pdf 409.5 kB
  • PDF/toilet.pdf 250.8 kB
  • PDF/tommy_tsunami_coloring_book.pdf 166.0 kB
  • PDF/tongue-twisters.pdf 53.5 kB
  • PDF/tongue_twisters.pdf 123.2 kB
  • PDF/tonguetwisters1.pdf 158.1 kB
  • PDF/too-and-enough_lesson.pdf 85.4 kB
  • PDF/too-much-too-many.pdf 1.2 MB
  • PDF/Tools and materials.pdf 217.9 kB
  • PDF/toucan_body-parts.pdf 37.8 kB
  • PDF/Tourism Vocabulary.pdf 220.6 kB
  • PDF/tourjeop.pdf 373.9 kB
  • PDF/towards-zero-waste.pdf 440.5 kB
  • PDF/toys-crossword.pdf 164.2 kB
  • PDF/toys-crossword_001.pdf 210.6 kB
  • PDF/toys-worksheets.pdf 292.2 kB
  • PDF/toysss.pdf 791.7 kB
  • PDF/tp-fony-a.pdf 131.1 kB
  • PDF/trace-1.pdf 325.6 kB
  • PDF/tracing-classroom-items.pdf 92.8 kB
  • PDF/traditional-foods.pdf 237.1 kB
  • PDF/traditionsorganizer.pdf 197.4 kB
  • PDF/traffic-offences-worksheet.pdf 41.0 kB
  • PDF/traffic.pdf 278.4 kB
  • PDF/trans.pdf 195.3 kB
  • PDF/transformation.pdf 51.2 kB
  • PDF/transport-1.pdf 1.0 MB
  • PDF/transport-dice.pdf 572.9 kB
  • PDF/transport-dice_001.pdf 415.6 kB
  • PDF/transport-game-2012.pdf 509.1 kB
  • PDF/transport-people.pdf 212.6 kB
  • PDF/Transport.pdf 206.4 kB
  • PDF/transport_001.pdf 212.5 kB
  • PDF/transport_002.pdf 208.6 kB
  • PDF/transportation elementary word search.pdf 217.7 kB
  • PDF/transportation-puzzle.pdf 26.9 kB
  • PDF/transportation.pdf 436.4 kB
  • PDF/transportss.pdf 229.3 kB
  • PDF/travel-double-puzzle.pdf 214.1 kB
  • PDF/Travel.pdf 215.7 kB
  • PDF/Travelling by sea.pdf 218.3 kB
  • PDF/travelling.pdf 548.6 kB
  • PDF/travelling_001.pdf 583.0 kB
  • PDF/travelling_002.pdf 65.3 kB
  • PDF/travis.pdf 118.8 kB
  • PDF/treasure-hunt-in-london.pdf 10.3 MB
  • PDF/treasure-island.pdf 1.8 MB
  • PDF/treasure.pdf 104.0 kB
  • PDF/trick-or-treat.pdf 84.0 kB
  • PDF/tsunami_curriculum_7_12.pdf 7.2 MB
  • PDF/tsunami_curriculum_k_6.pdf 3.1 MB
  • PDF/tsv-spelling-assessment.pdf 109.2 kB
  • PDF/turnin.pdf 163.9 kB
  • PDF/turtles_identifying-parts-of-info-text.pdf 310.8 kB
  • PDF/TV wordsearch.pdf 212.1 kB
  • PDF/tv-activities-pan-am-pilot-upload.pdf 365.9 kB
  • PDF/tv-advantages-and-disadvantages.pdf 37.0 kB
  • PDF/tv-programmes.pdf 881.9 kB
  • PDF/types-of-nonverbal-communication-and-body-language.pdf 549.2 kB
  • PDF/typhoid-mary.pdf 593.1 kB
  • PDF/u.pdf 874.3 kB
  • PDF/u2-i-still-havent-found-what-im-looking-for.pdf 80.9 kB
  • PDF/u2-song-worksheet.pdf 51.4 kB
  • PDF/uk-bingo.pdf 343.0 kB
  • PDF/umbrella-guide.pdf 84.2 kB
  • PDF/unbreak-my-heart-toni-braxton.pdf 74.9 kB
  • PDF/under-the-bridge-red-hot-chilli-peppers.pdf 449.0 kB
  • PDF/under-the-sea-ppt.pdf 408.5 kB
  • PDF/unforgettable_songs.pdf 238.6 kB
  • PDF/unicef-shakira.pdf 77.7 kB
  • PDF/unit-1-bon-jovi-ugly.pdf 23.0 kB
  • PDF/unit-10-movies-copy.pdf 39.2 kB
  • PDF/unit-15-speaking.pdf 944.0 kB
  • PDF/unit-2-corinne-bailey-rae-put-your-records-on.pdf 125.9 kB
  • PDF/unit-2-reporting-statements.pdf 549.0 kB
  • PDF/unit-3.pdf 191.1 kB
  • PDF/unit7_warmer.pdf 204.0 kB
  • PDF/UNITS OF MEASUREMENT VOCABULARY.pdf 218.3 kB
  • PDF/UNITS.pdf 215.9 kB
  • PDF/University life.pdf 218.3 kB
  • PDF/uno-juego-cartas.pdf 667.6 kB
  • PDF/unreal_conditions.pdf 129.8 kB
  • PDF/unscramble-sentences-personal-info.pdf 185.9 kB
  • PDF/unusual-jobs-living-statues.pdf 238.9 kB
  • PDF/up-adjectives-and-characters.pdf 210.2 kB
  • PDF/up.pdf 4.3 MB
  • PDF/uprising-by-muse.pdf 90.4 kB
  • PDF/ups-and-downs.pdf 234.0 kB
  • PDF/Urban landscapes - Word Search.pdf 214.2 kB
  • PDF/us-pledge-of-allegiance.pdf 150.3 kB
  • PDF/us-warning-over-risk-of-cyber-attacks.pdf 63.5 kB
  • PDF/use-your-head-part-1-and-2.pdf 208.6 kB
  • PDF/used-to-chris-daughtry.pdf 84.0 kB
  • PDF/used-to.pdf 280.8 kB
  • PDF/used-to_001.pdf 186.2 kB
  • PDF/using_songs.pdf 88.6 kB
  • PDF/using_songs_001.pdf 88.6 kB
  • PDF/usual_suspects.pdf 992.8 kB
  • PDF/utensils-exercise.pdf 80.8 kB
  • PDF/vacation-time-ross-and-rachel.pdf 54.8 kB
  • PDF/valentine-1.pdf 644.1 kB
  • PDF/valentine-2.pdf 694.7 kB
  • PDF/valentine-board-game.pdf 953.4 kB
  • PDF/valentine-dice.pdf 302.9 kB
  • PDF/valentine-match1.pdf 592.8 kB
  • PDF/valentine-pict..pdf 672.9 kB
  • PDF/valentine180s-colouring.pdf 791.1 kB
  • PDF/valentine_candy.pdf 28.4 kB
  • PDF/valentines-around-the-world.pdf 60.6 kB
  • PDF/valentines-day-grammar.pdf 165.7 kB
  • PDF/valentines-day-hugs-n-kisses.pdf 138.3 kB
  • PDF/valentines-day-surprise.pdf 64.8 kB
  • PDF/valentines-day-the-big-bang-theory-s3e15-mar.pdf 255.1 kB
  • PDF/valentines-day.pdf 324.8 kB
  • PDF/valentines-day_001.pdf 104.2 kB
  • PDF/valentines-maze.pdf 360.2 kB
  • PDF/valentines.pdf 72.5 kB
  • PDF/valwords.pdf 61.4 kB
  • PDF/vampire.pdf 184.5 kB
  • PDF/vegetable-bingo-cards.pdf 98.6 kB
  • PDF/vegetables-2012.pdf 712.7 kB
  • PDF/vegetables-karta-pracy.pdf 1.0 MB
  • PDF/vegetables-matching-word-and-picture.pdf 190.2 kB
  • PDF/verb-tense-charts.pdf 48.6 kB
  • PDF/verb-tenses-grid.pdf 303.8 kB
  • PDF/verb-to-be-board-game.pdf 683.7 kB
  • PDF/verb-to-be-contest.pdf 41.5 kB
  • PDF/verb-to-be-dec2011.pdf 401.2 kB
  • PDF/verb-to-be-in-singular.pdf 444.2 kB
  • PDF/verb-to-be-mistakes.pdf 208.0 kB
  • PDF/verb-to-be-simple-past.pdf 623.5 kB
  • PDF/verb-to-be-table.pdf 34.0 kB
  • PDF/verb-to-be.pdf 135.1 kB
  • PDF/verb-to-be_simple-past.pdf 51.0 kB
  • PDF/verbal-tenses.pdf 5.0 MB
  • PDF/verbs-cards.pdf 1.5 MB
  • PDF/verbs-dominoes.pdf 195.6 kB
  • PDF/verbs-i-drink.pdf 32.5 kB
  • PDF/verbs-of-gerund-and-infinitive.pdf 121.3 kB
  • PDF/verbs-with-preposition3.pdf 135.9 kB
  • PDF/verbs-with-prepositions-2.pdf 299.1 kB
  • PDF/verbs.pdf 82.7 kB
  • PDF/Verbs_001.pdf 212.1 kB
  • PDF/verbs_002.pdf 351.4 kB
  • PDF/verbs_003.pdf 121.7 kB
  • PDF/verbs_004.pdf 243.1 kB
  • PDF/verbsheet.pdf 14.3 kB
  • PDF/verbtensestables.pdf 95.5 kB
  • PDF/video-activity-chips.pdf 63.3 kB
  • PDF/video-games-by-lana-del-rey.pdf 199.9 kB
  • PDF/video-lesson-mr-bean-appointment-with-the-dentist.pdf 214.0 kB
  • PDF/video-lesson-spanglish.pdf 284.5 kB
  • PDF/video-listening-comprehension-im-an-animal.pdf 73.8 kB
  • PDF/video-session-rise-of-the-planet-of-the-apes.pdf 210.7 kB
  • PDF/video-session-spanglish_language-learners.pdf 143.6 kB
  • PDF/views-and-arguments.pdf 74.0 kB
  • PDF/vincent-van-gogh.pdf 42.8 kB
  • PDF/visiting-london-prepositions.pdf 57.5 kB
  • PDF/voa-broadcast-johnny-appleseed.pdf 48.8 kB
  • PDF/voc-what-can-you-do-in-canada.pdf 365.8 kB
  • PDF/vocab-ec-club-msw.pdf 312.7 kB
  • PDF/vocab-organizer.pdf 208.6 kB
  • PDF/vocab-weather-season-camping.pdf 2.2 MB
  • PDF/vocabcardseslkorean.pdf 127.9 kB
  • PDF/Vocabulary Unit 4 NEF Pre-intermediate Clothes.pdf 218.4 kB
  • PDF/vocabulary-count.pdf 1.1 MB
  • PDF/vocabulary-for-book-reviews.pdf 56.5 kB
  • PDF/vocabulary-test-verbs.pdf 179.5 kB
  • PDF/Volunteers Elementary Word Search.pdf 218.2 kB
  • PDF/voprosy-legkie.pdf 926.5 kB
  • PDF/vote-13.pdf 1.2 MB
  • PDF/vowel-sounds-phonics-assessment.pdf 262.3 kB
  • PDF/vrerbs-missing.pdf 1.7 MB
  • PDF/wake-me-in-spring-reader.pdf 180.4 kB
  • PDF/walk-on-by-dionne-warwick.pdf 192.1 kB
  • PDF/wall-e-complete.pdf 329.9 kB
  • PDF/wall-e-completo.pdf 645.8 kB
  • PDF/waltermittycharacteranalysis.pdf 19.5 kB
  • PDF/war-context-research-grid.pdf 95.2 kB
  • PDF/warm-up-tongue-twisters.pdf 35.2 kB
  • PDF/warmers.pdf 354.8 kB
  • PDF/was-or-were-when-you-were-mine-song.pdf 46.9 kB
  • PDF/was-were.pdf 31.2 kB
  • PDF/washroom_story_einsteing_chauffer.pdf 67.9 kB
  • PDF/watch-the-video-and-answer-the-questions.pdf 49.3 kB
  • PDF/watch-the-video-and-complete-the-sentences.pdf 63.6 kB
  • PDF/watemelon-pizza-icecream.pdf 282.2 kB
  • PDF/water-cooperation.pdf 46.7 kB
  • PDF/watermelon-puppet.pdf 31.4 kB
  • PDF/watermelon-slices.pdf 43.8 kB
  • PDF/waving-flag.pdf 2.3 MB
  • PDF/waving-flag_worksheet_and_key.pdf 136.6 kB
  • PDF/ways-you-can-help-your-child-this-summer.pdf 189.0 kB
  • PDF/we-are-going-to-be-friends.pdf 18.2 kB
  • PDF/we-are-never-ever-getting-back-together.pdf 96.8 kB
  • PDF/we-areyoung.pdf 37.6 kB
  • PDF/we-bought-a-zoo.pdf 1.0 MB
  • PDF/weareyoung2.pdf 50.0 kB
  • PDF/Weather and seasons.pdf 216.1 kB
  • PDF/Weather Intermediate Word Search.pdf 220.3 kB
  • PDF/weather-2.pdf 683.7 kB
  • PDF/weather-crossword-2012.pdf 638.5 kB
  • PDF/weather-cut.pdf 374.7 kB
  • PDF/weather-exercises-2.pdf 144.4 kB
  • PDF/weather-flash2.pdf 1.9 MB
  • PDF/weather-mc.pdf 529.6 kB
  • PDF/weather-mini-bw.pdf 234.4 kB
  • PDF/weather-pict.pdf 894.8 kB
  • PDF/weather-symbols.pdf 84.8 kB
  • PDF/Weather.pdf 212.0 kB
  • PDF/Weather_001.pdf 216.2 kB
  • PDF/weather_002.pdf 231.5 kB
  • PDF/weather_003.pdf 370.6 kB
  • PDF/weather_004.pdf 96.7 kB
  • PDF/weather_005.pdf 804.6 kB
  • PDF/weather_chart_with_sign.pdf 455.3 kB
  • PDF/weather_words.pdf 161.5 kB
  • PDF/weatherclothesearch.pdf 156.4 kB
  • PDF/web-search-london.pdf 71.3 kB
  • PDF/weblish-worksheet.pdf 338.0 kB
  • PDF/webquest-modal-verbs-ppt.pdf 3.7 MB
  • PDF/websites.pdf 133.6 kB
  • PDF/wedding-fun-book.pdf 561.2 kB
  • PDF/wedding-pictionary.pdf 375.2 kB
  • PDF/week.pdf 56.2 kB
  • PDF/weekdays.pdf 170.5 kB
  • PDF/weird-transportation.pdf 509.8 kB
  • PDF/welcome-2-unit-11-dialogue.pdf 217.8 kB
  • PDF/welcome-back-to-school.pdf 2.8 MB
  • PDF/welcome-back-to-school_001.pdf 522.2 kB
  • PDF/welcome-to-grade-x.pdf 177.6 kB
  • PDF/west-life-song-my-love-worksheets.pdf 80.2 kB
  • PDF/wether-flash-2013.pdf 2.1 MB
  • PDF/wf_boardgame.pdf 16.9 kB
  • PDF/wf_boardgame_001.pdf 16.9 kB
  • PDF/wg-part-1.pdf 56.1 kB
  • PDF/wh-question-word-post-office-et-cinema-avanc.pdf 282.7 kB
  • PDF/wh-questions-and-answers.pdf 448.4 kB
  • PDF/wh-questions-board-game.pdf 446.5 kB
  • PDF/wh-questions-daily-routine.pdf 78.9 kB
  • PDF/wh-questions-game.pdf 200.7 kB
  • PDF/wh.pdf 938.9 kB
  • PDF/What kind of movies do you like to watch.pdf 220.0 kB
  • PDF/what-a-hit.pdf 626.9 kB
  • PDF/what-a-life.pdf 129.0 kB
  • PDF/what-a-wonderful-world-by-ramone.pdf 262.6 kB
  • PDF/what-a-wonderful-world.pdf 717.8 kB
  • PDF/what-a-wonderful-world_001.pdf 65.9 kB
  • PDF/what-animal-am-i.pdf 117.9 kB
  • PDF/what-are-they-doing.pdf 695.6 kB
  • PDF/what-are-they-going-to-do-next-summer.pdf 414.3 kB
  • PDF/what-are-they-wearing.pdf 645.3 kB
  • PDF/what-are-they-wearing_001.pdf 645.3 kB
  • PDF/what-are-they.pdf 150.1 kB
  • PDF/what-are-you-doing.pdf 841.6 kB
  • PDF/what-are-you-wearing.pdf 46.2 kB
  • PDF/what-can-you-do.pdf 183.8 kB
  • PDF/what-colour-is-it_eng.pdf 3.7 kB
  • PDF/what-di-you-do-for-your-holiday.pdf 18.4 kB
  • PDF/what-did-you-do-wksht-shared.pdf 56.4 kB
  • PDF/what-do-you-do-in-class.pdf 626.7 kB
  • PDF/what-food-do-you-like.pdf 1.5 MB
  • PDF/what-happens-next.pdf 29.6 kB
  • PDF/what-id-squirrel-thinking.pdf 104.5 kB
  • PDF/what-is-a-santa-claus-by-stan-kenton.pdf 90.3 kB
  • PDF/what-is-an-election.pdf 130.0 kB
  • PDF/what-is-in-the-fridge.pdf 351.2 kB
  • PDF/what-is-that-animal.pdf 212.6 kB
  • PDF/what-is-your-favourite-item-of-clothes.pdf 61.6 kB
  • PDF/what-makes-you-beautiful-activity.pdf 48.6 kB
  • PDF/what-people-are-doing.pdf 37.7 kB
  • PDF/what-question-worksheet.pdf 45.1 kB
  • PDF/what-s-the-weather-like-pair-work.pdf 269.9 kB
  • PDF/what-sort-of-language-learner-are-you.pdf 71.8 kB
  • PDF/what-they-said-what-they-meant.pdf 57.1 kB
  • PDF/what-time-information-gap.pdf 64.5 kB
  • PDF/what-time-is-it-worksheet.pdf 224.7 kB
  • PDF/what-time-is-it.pdf 81.7 kB
  • PDF/what-went-wrong-on-holiday.pdf 361.1 kB
  • PDF/what-were-your-favorite-games-when-u-were-a-child.pdf 2.8 MB
  • PDF/what_are_they_doing.pdf 98.6 kB
  • PDF/Whats the weather like.pdf 207.5 kB
  • PDF/whats-the-hobby.pdf 478.5 kB
  • PDF/whats-your-favorite-food.pdf 257.8 kB
  • PDF/whats-your-reaction-preferences.pdf 47.8 kB
  • PDF/whats_the_time.pdf 58.4 kB
  • PDF/whats_the_time_001.pdf 58.4 kB
  • PDF/wheelstoteachpartsofthebody.pdf 111.5 kB
  • PDF/when-i-grow-up-art-activity.pdf 121.3 kB
  • PDF/when-is.pdf 21.6 kB
  • PDF/when-you-are-gone.pdf 2.3 MB
  • PDF/where-are-they-from-2.pdf 267.8 kB
  • PDF/where-are-they-from-3.pdf 152.5 kB
  • PDF/where-is-mark.pdf 130.4 kB
  • PDF/where-the-hell-is-matt-busyteacher.pdf 94.3 kB
  • PDF/where-the-wild-roses-grow.pdf 53.4 kB
  • PDF/which-painting-do-you-like.pdf 311.1 kB
  • PDF/white-christmas.pdf 400.2 kB
  • PDF/white-house-easter-egg-roll-2007-coloring-and.pdf 1.8 MB
  • PDF/who-am-i-describing.pdf 20.0 kB
  • PDF/who-am-i-game.pdf 305.5 kB
  • PDF/who-am-i-lines.pdf 1.1 MB
  • PDF/who-are-these-people-simple-present-exercise.pdf 228.9 kB
  • PDF/who-are-they.pdf 534.4 kB
  • PDF/who-are-you.pdf 108.6 kB
  • PDF/who-is-she.pdf 236.9 kB
  • PDF/who-is-who.pdf 318.1 kB
  • PDF/who-said-what.pdf 161.8 kB
  • PDF/who-wants-to-be-a-millionaire-1.pdf 295.8 kB
  • PDF/who_where_when_why_what-questions_ana.pdf 318.3 kB
  • PDF/whose-backpack-is-this-genitive-case.pdf 543.1 kB
  • PDF/why-are-you-staring-at-me.pdf 174.0 kB
  • PDF/why-you-are-not-getting-a-promotion.pdf 100.9 kB
  • PDF/wicked-game.pdf 68.6 kB
  • PDF/wiki-introduction.pdf 85.1 kB
  • PDF/wild-animals-match.pdf 666.1 kB
  • PDF/wild-animals-wordsearch-21012.pdf 573.6 kB
  • PDF/wild_animals.pdf 381.2 kB
  • PDF/wildagain.pdf 269.4 kB
  • PDF/Wildlife Elementary Word Search.pdf 212.0 kB
  • PDF/will-be-going-to.pdf 291.2 kB
  • PDF/will_going_to.pdf 1.8 MB
  • PDF/willgoing-to-present-continuous.pdf 91.0 kB
  • PDF/willgoingtopictures.pdf 416.3 kB
  • PDF/window.pdf 273.4 kB
  • PDF/windows-down-big-time-rush.pdf 42.2 kB
  • PDF/winter-2011.pdf 894.9 kB
  • PDF/winter-activities.pdf 62.7 kB
  • PDF/winter-flascards-2011.pdf 870.1 kB
  • PDF/winter-olympics-sports.pdf 3.8 MB
  • PDF/winter-storybook-100-days.pdf 555.3 kB
  • PDF/winter-vocabulary-domino.pdf 173.7 kB
  • PDF/wire_to_wire.pdf 168.8 kB
  • PDF/wisest.pdf 257.7 kB
  • PDF/wish-exercise-inc.pdf 581.4 kB
  • PDF/wish-past.pdf 236.3 kB
  • PDF/wish_2008.pdf 48.7 kB
  • PDF/wish_2008_001.pdf 48.7 kB
  • PDF/wish_if_only_revision_stories_handout.pdf 435.0 kB
  • PDF/wishes.pdf 210.7 kB
  • PDF/wishes_001.pdf 210.7 kB
  • PDF/within-temptation-bittersweet-warm-up.pdf 59.6 kB
  • PDF/without-you-worksheet.pdf 22.3 kB
  • PDF/without-you.pdf 28.4 kB
  • PDF/wk-3-song-summer-nights-past-tense-verbs.pdf 35.9 kB
  • PDF/wk_eng_wksheet_001-key.pdf 34.2 kB
  • PDF/wk_eng_wksheet_001.pdf 32.3 kB
  • PDF/wkst-busyteacher.pdf 14.6 kB
  • PDF/womens-wear-decoding.pdf 151.3 kB
  • PDF/wonderwall-oasis.pdf 248.1 kB
  • PDF/woodkid-i-love-you.pdf 97.4 kB
  • PDF/word-building-a.pdf 39.9 kB
  • PDF/word-family.pdf 144.6 kB
  • PDF/word-formation.pdf 223.7 kB
  • PDF/word-formation_001.pdf 203.5 kB
  • PDF/word-formation_002.pdf 91.7 kB
  • PDF/word-formation_003.pdf 100.6 kB
  • PDF/word-order-in-english.pdf 605.2 kB
  • PDF/word-order-subjects.pdf 105.8 kB
  • PDF/word-search-entertainment.pdf 271.5 kB
  • PDF/word-stress-and-word-stress-in-the-sentence.pdf 273.3 kB
  • PDF/word_bank-halloween.pdf 524.7 kB
  • PDF/word_bank-learning_english.pdf 438.7 kB
  • PDF/word_bank-shopping.pdf 357.3 kB
  • PDF/word_search-emotions.pdf 386.7 kB
  • PDF/word_spider.pdf 427.5 kB
  • PDF/word_spider_001.pdf 427.5 kB
  • PDF/Words with Suffixes and Prefixes Wordsearch.pdf 212.4 kB
  • PDF/words-beginning-with-t.pdf 282.0 kB
  • PDF/words-for-manners-bingo.pdf 20.2 kB
  • PDF/words-with-long-vowel-aa.pdf 330.9 kB
  • PDF/words-with-long-vowel-aa_001.pdf 116.7 kB
  • PDF/words.pdf 21.6 kB
  • PDF/words_001.pdf 233.2 kB
  • PDF/wordsearch-english.pdf 52.0 kB
  • PDF/wordsearch-house-furniture-2nd-feb-2010.pdf 228.4 kB
  • PDF/wordsearch-review-calendar-and-greetings.pdf 145.7 kB
  • PDF/working-hard.pdf 262.9 kB
  • PDF/workplace-scenarios-1.pdf 28.5 kB
  • PDF/worksheet-2.pdf 1.6 MB
  • PDF/worksheet-6_1b_wordsearch-public-places.pdf 147.6 kB
  • PDF/worksheet-activit-comparatives.pdf 83.8 kB
  • PDF/worksheet-circle-the-animals-that-live-in-the-sea.pdf 614.8 kB
  • PDF/worksheet-colours.pdf 45.7 kB
  • PDF/worksheet-eight-days-a-week.pdf 59.3 kB
  • PDF/worksheet-lesson-2.pdf 452.8 kB
  • PDF/worksheet-on-describing-words-for-busyteacher.pdf 206.8 kB
  • PDF/worksheet-present-continuous.pdf 351.2 kB
  • PDF/worksheet-present-simple.pdf 90.1 kB
  • PDF/worksheet-project-glass.pdf 134.0 kB
  • PDF/worksheet-review-prepositions-_-simple-present.pdf 48.2 kB
  • PDF/worksheet-the-joneses.pdf 551.7 kB
  • PDF/worksheet-this-is-the-last-time.pdf 70.3 kB
  • PDF/worksheet-to-practise-forming-questions.pdf 34.7 kB
  • PDF/worksheet.pdf 115.5 kB
  • PDF/worksheet_-sports-and-hobbies.pdf 492.3 kB
  • PDF/worksheet_film_the_descendants.pdf 432.8 kB
  • PDF/worksheets-comparatives.pdf 370.5 kB
  • PDF/worksheets.pdf 833.1 kB
  • PDF/worksheets_001.pdf 833.1 kB
  • PDF/World Health Day 7th April.pdf 218.0 kB
  • PDF/world_water_day_2011.pdf 3.3 MB
  • PDF/worldcup-in-many-languages.pdf 603.4 kB
  • PDF/worst-bed-story-ever.pdf 32.1 kB
  • PDF/worst.pdf 216.1 kB
  • PDF/write-a-story-using-words.pdf 50.7 kB
  • PDF/write-a-summary-in-3-steps.pdf 705.5 kB
  • PDF/write-questions-for-these-answers.pdf 68.4 kB
  • PDF/write-the-correct-preposition.pdf 103.7 kB
  • PDF/write-the-past-form-of-the-verbs-in-brackets.pdf 51.7 kB
  • PDF/write-your-own-newspaper-article.pdf 454.9 kB
  • PDF/writing-a-corporative-email.pdf 1.7 MB
  • PDF/writing-a-paragraph.pdf 231.9 kB
  • PDF/writing-a-postcard.pdf 1.0 MB
  • PDF/writing-a-setting.pdf 37.0 kB
  • PDF/writing-diversity.pdf 72.4 kB
  • PDF/writing-famous-person.pdf 102.0 kB
  • PDF/writing-lesson-plans.pdf 112.2 kB
  • PDF/writing-modal-verbs.pdf 178.2 kB
  • PDF/writing-prompt-nogift.pdf 130.0 kB
  • PDF/writing-prompt-toy.pdf 134.2 kB
  • PDF/writing-skills.pdf 40.5 kB
  • PDF/writing.pdf 55.6 kB
  • PDF/writing_001.pdf 232.3 kB
  • PDF/writing_002.pdf 111.7 kB
  • PDF/written-test.pdf 21.3 kB
  • PDF/x-mas-quiz.pdf 2.6 MB
  • PDF/xmas.pdf 250.8 kB
  • PDF/xmas_borders1.pdf 9.4 MB
  • PDF/xmas_borders_2.pdf 3.3 MB
  • PDF/xmas_borders_3.pdf 189.1 kB
  • PDF/xmasgame.pdf 91.3 kB
  • PDF/xmasgame_001.pdf 91.3 kB
  • PDF/y-entonces-lleg243-ella_along-came-polly_vf.pdf 406.3 kB
  • PDF/y-entonces-lleg243-ella_along-came-polly_vf_001.pdf 406.2 kB
  • PDF/year-end-activities.pdf 175.6 kB
  • PDF/yearlong_11-12-reduced.pdf 19.2 MB
  • PDF/yellow-spotted-lizards-reading.pdf 226.8 kB
  • PDF/yellow-submarine.pdf 57.2 kB
  • PDF/yes-no-sentence-sort-activity-12.pdf 250.1 kB
  • PDF/yesterday-from-esl-video.pdf 33.0 kB
  • PDF/yo-yee-school-subjects.pdf 339.9 kB
  • PDF/yo-yee-shapes.pdf 85.2 kB
  • PDF/yosemite-sam-bugs-bunny-rabbitson-crusoe.pdf 200.8 kB
  • PDF/yosemite.pdf 310.8 kB
  • PDF/you-gave-the-strenght-to-me.pdf 100.2 kB
  • PDF/you-have-a-friend-in-me-activity-plan-4.pdf 69.7 kB
  • PDF/you.pdf 24.1 kB
  • PDF/you_and_money-second-conditional.pdf 267.8 kB
  • PDF/young-folks-by-the-kooks.pdf 214.0 kB
  • PDF/young-folks.pdf 68.1 kB
  • PDF/your-dream-company.pdf 28.1 kB
  • PDF/your-friend-went-to-a-party-last-night-to-be-past.pdf 25.0 kB
  • PDF/your-house_crossword.pdf 27.6 kB
  • PDF/your-perfect-vacation.pdf 25.7 kB
  • PDF/your-time-line.pdf 173.0 kB
  • PDF/your-time-will-come-amy-macdonald.pdf 26.2 kB
  • PDF/youre-gonna-lose-that-girl.pdf 399.8 kB
  • PDF/youre-not-supposed-to-do-that-lilo-stitch.pdf 391.9 kB
  • PDF/youve-got-a-friend.pdf 28.3 kB
  • PDF/yummybingo.pdf 873.9 kB
  • PDF/zaimki-osobowe-i-przymiotniki.pdf 134.1 kB
  • PDF/zapovednacparkzoosaf.pdf 1.5 MB
  • PDF/zaproszenia.pdf 29.2 kB
  • PDF/zerocond.pdf 106.6 kB
  • PDF/Zodiac.pdf 219.9 kB
  • PDF/zoe.pdf 240.1 kB
  • PDF/zoo-animals.pdf 782.9 kB
  • PDF/zoodiac.pdf 740.3 kB
  • PDF/zorro-alphabet-abc.pdf 394.2 kB
  • PDF/zorro-alphabet-def.pdf 214.4 kB
  • PDF/zorro-alphabet-ghi.pdf 294.4 kB
  • PDF/zorro-alphabet-jkl.pdf 216.0 kB
  • PDF/zorro-alphabet-mno.pdf 230.5 kB
  • PDF/zorro-alphabet-pqr.pdf 205.6 kB
  • PPT 97-2003/-ing-adjectives.ppt 1.4 MB
  • PPT 97-2003/1.ppt 7.6 MB
  • PPT 97-2003/12-powerful-words_review.ppt 333.8 kB
  • PPT 97-2003/20-questions-game-questions.ppt 413.2 kB
  • PPT 97-2003/2012-005-03-draw-and-color-shapes.ppt 182.8 kB
  • PPT 97-2003/25-classroom-verbs.ppt 1.5 MB
  • PPT 97-2003/2nd-conditional-ppttt.ppt 753.2 kB
  • PPT 97-2003/2ndgrread2.ppt 668.7 kB
  • PPT 97-2003/2ndlessontopicsentence.ppt 124.4 kB
  • PPT 97-2003/30.ppt 188.9 kB
  • PPT 97-2003/576_the-mistery-of-wales.ppt 87.6 kB
  • PPT 97-2003/63pres.ppt 221.2 kB
  • PPT 97-2003/7-verb-to-be.ppt 5.6 MB
  • PPT 97-2003/a-quiz-general-knowledge.ppt 374.8 kB
  • PPT 97-2003/abcedario.ppt 3.0 MB
  • PPT 97-2003/acronyms.ppt 693.8 kB
  • PPT 97-2003/actions.ppt 1.7 MB
  • PPT 97-2003/active-and-passive-verbs.ppt 18.4 kB
  • PPT 97-2003/active-and-passive-voice.ppt 681.0 kB
  • PPT 97-2003/addressing-a-letter.ppt 841.2 kB
  • PPT 97-2003/adjective-clauses-mod.ppt 1.5 MB
  • PPT 97-2003/Adjective_Clauses_mod.ppt 1.8 MB
  • PPT 97-2003/Adjective_Clauses_mod_001.ppt 1.8 MB
  • PPT 97-2003/adjectives-and-adverbs.ppt 218.6 kB
  • PPT 97-2003/adjectives.ppt 1.7 MB
  • PPT 97-2003/adjectives_001.ppt 1.2 MB
  • PPT 97-2003/adjectives_002.ppt 1.2 MB
  • PPT 97-2003/adjectives_003.ppt 3.2 MB
  • PPT 97-2003/adjectives_004.ppt 171.0 kB
  • PPT 97-2003/adjectives_005.ppt 1.2 MB
  • PPT 97-2003/adverb-or-adjective-doctor-patient-joke-powerpoint.ppt 291.8 kB
  • PPT 97-2003/adverbs-adjective.ppt 210.9 kB
  • PPT 97-2003/alphabet-.ppt 895.0 kB
  • PPT 97-2003/american-holidays.ppt 7.6 MB
  • PPT 97-2003/an-ice-hotel.ppt 8.8 MB
  • PPT 97-2003/an_on_in.ppt 389.1 kB
  • PPT 97-2003/animal-presentation.ppt 5.0 MB
  • PPT 97-2003/animal-presentation_001.ppt 5.1 MB
  • PPT 97-2003/animals-safari-be-ing.ppt 10.1 MB
  • PPT 97-2003/animals.ppt 484.9 kB
  • PPT 97-2003/argumentative-essay-e-class-module-3.ppt 553.5 kB
  • PPT 97-2003/art.ppt 10.0 MB
  • PPT 97-2003/articles.ppt 259.1 kB
  • PPT 97-2003/articles_001.ppt 1.5 MB
  • PPT 97-2003/ask-your-partner.ppt 1.0 MB
  • PPT 97-2003/asking-for-and-giving-directions.ppt 290.8 kB
  • PPT 97-2003/asking-questions.ppt 307.2 kB
  • PPT 97-2003/at-the-zoo.ppt 2.8 MB
  • PPT 97-2003/b-day-vocabulary.ppt 1.5 MB
  • PPT 97-2003/back-to-the-future.ppt 3.0 MB
  • PPT 97-2003/baralho.ppt 947.7 kB
  • PPT 97-2003/bedroom.ppt 1.8 MB
  • PPT 97-2003/big-small.ppt 652.8 kB
  • PPT 97-2003/big_board_answers-env.ppt 2.4 MB
  • PPT 97-2003/billy-goats-gruff1.ppt 3.3 MB
  • PPT 97-2003/body.ppt 3.6 MB
  • PPT 97-2003/bored-or-boring.ppt 430.1 kB
  • PPT 97-2003/business-english-1.ppt 160.3 kB
  • PPT 97-2003/calendar.ppt 1.3 MB
  • PPT 97-2003/can-and-cant-slide-show.ppt 4.0 MB
  • PPT 97-2003/can.ppt 999.9 kB
  • PPT 97-2003/character.ppt 1.9 MB
  • PPT 97-2003/chicken-licken-ppt-sample.ppt 4.0 MB
  • PPT 97-2003/christmas-game.ppt 3.9 MB
  • PPT 97-2003/christmas-new-year.ppt 1.6 MB
  • PPT 97-2003/christmas-story.ppt 8.5 MB
  • PPT 97-2003/classroom-game.ppt 1.2 MB
  • PPT 97-2003/classroom-instructions.ppt 822.3 kB
  • PPT 97-2003/classroom-language-for-physical-education.ppt 1.8 MB
  • PPT 97-2003/classroom-language-reloaded.ppt 1.1 MB
  • PPT 97-2003/classroom-language.ppt 4.7 MB
  • PPT 97-2003/classroom-management-part-1.ppt 731.1 kB
  • PPT 97-2003/classroom-management-part-2-.ppt 602.1 kB
  • PPT 97-2003/clothes.ppt 3.0 MB
  • PPT 97-2003/clothes_001.ppt 697.3 kB
  • PPT 97-2003/clothes_002.ppt 8.4 MB
  • PPT 97-2003/clothes_003.ppt 1.2 MB
  • PPT 97-2003/colors-and-numbers.ppt 272.9 kB
  • PPT 97-2003/colour-idioms.ppt 134.1 kB
  • PPT 97-2003/colours-with-sound.ppt 1.3 MB
  • PPT 97-2003/colours.ppt 1.8 MB
  • PPT 97-2003/comparative.ppt 1.8 MB
  • PPT 97-2003/comparatives-superlatives.ppt 821.2 kB
  • PPT 97-2003/compare-people.ppt 444.9 kB
  • PPT 97-2003/comparison-of-adjectives-practice.ppt 444.9 kB
  • PPT 97-2003/comparison-the-rule.ppt 3.6 MB
  • PPT 97-2003/comparison21.ppt 1.5 MB
  • PPT 97-2003/competition.ppt 10.4 MB
  • PPT 97-2003/computers-me.ppt 641.5 kB
  • PPT 97-2003/condional-sentences.ppt 3.5 MB
  • PPT 97-2003/condional-sentences_001.ppt 3.5 MB
  • PPT 97-2003/condional-sentences_002.ppt 3.5 MB
  • PPT 97-2003/conditional-clauses-introduces-by-when-unless.ppt 874.5 kB
  • PPT 97-2003/conditional-clauses-introduces-by-when-unless_001.ppt 883.2 kB
  • PPT 97-2003/conditionals-0123.ppt 2.0 MB
  • PPT 97-2003/conditionals.ppt 3.0 MB
  • PPT 97-2003/conditionals_001.ppt 373.2 kB
  • PPT 97-2003/conditionals_002.ppt 3.1 MB
  • PPT 97-2003/conjuctions-but-because-and-esl-1.ppt 1.8 MB
  • PPT 97-2003/cooking-verbs.ppt 1.3 MB
  • PPT 97-2003/cooking-verbs_001.ppt 1.4 MB
  • PPT 97-2003/cooking-vocabulary.ppt 6.9 MB
  • PPT 97-2003/cooking.ppt 3.9 MB
  • PPT 97-2003/cooking_001.ppt 4.7 MB
  • PPT 97-2003/count-uncoun-nxpowerlite.ppt 1.5 MB
  • PPT 97-2003/countable-uncountable-nouns.ppt 2.3 MB
  • PPT 97-2003/countries-and-nationalities.ppt 364.5 kB
  • PPT 97-2003/countries-and-nationalities_001.ppt 1.8 MB
  • PPT 97-2003/culinary-and-catering.ppt 3.4 MB
  • PPT 97-2003/daily-routines-presentaci243n.ppt 1.8 MB
  • PPT 97-2003/daily-routines.ppt 1.0 MB
  • PPT 97-2003/daily-routines_001.ppt 206.3 kB
  • PPT 97-2003/dailyroutine.ppt 3.3 MB
  • PPT 97-2003/dates.ppt 761.3 kB
  • PPT 97-2003/days-of-the-week-presentation.ppt 1.3 MB
  • PPT 97-2003/days.ppt 1.0 MB
  • PPT 97-2003/degrees-of-comparison.ppt 844.3 kB
  • PPT 97-2003/describing-people2.ppt 2.3 MB
  • PPT 97-2003/describing-people2_amend.ppt 2.7 MB
  • PPT 97-2003/desert-island.ppt 1.6 MB
  • PPT 97-2003/did.ppt 714.8 kB
  • PPT 97-2003/did_001.ppt 812.0 kB
  • PPT 97-2003/directions-exercise.ppt 3.2 MB
  • PPT 97-2003/directions-full.ppt 82.4 kB
  • PPT 97-2003/directions2.ppt 4.3 MB
  • PPT 97-2003/directons-2.ppt 207.9 kB
  • PPT 97-2003/disasters.ppt 4.0 MB
  • PPT 97-2003/discipline-poster-grade-1-22010-2011.ppt 331.8 kB
  • PPT 97-2003/discussion-sheet_puff.ppt 199.7 kB
  • PPT 97-2003/discussion-yelda.ppt 1.5 MB
  • PPT 97-2003/do-play-go.ppt 755.2 kB
  • PPT 97-2003/do-play-go_001.ppt 1.2 MB
  • PPT 97-2003/do-you-look-like-your-dog.ppt 3.3 MB
  • PPT 97-2003/early-devices-and-moders-devices.ppt 951.8 kB
  • PPT 97-2003/easterppt.ppt 2.4 MB
  • PPT 97-2003/emotions.ppt 7.0 MB
  • PPT 97-2003/endangered-animals.ppt 4.3 MB
  • PPT 97-2003/endangered-species-2010.ppt 1.2 MB
  • PPT 97-2003/england.ppt 1.1 MB
  • PPT 97-2003/english-competition-7-8.ppt 428.5 kB
  • PPT 97-2003/english-is-fun.ppt 1.0 MB
  • PPT 97-2003/english-renaissance-writers3.ppt 4.5 MB
  • PPT 97-2003/english-with-jonnnik-groundhog.ppt 1.1 MB
  • PPT 97-2003/english-with-jonnnik-st-vl.ppt 2.2 MB
  • PPT 97-2003/english-with-jonnnik-val-day.ppt 138.2 kB
  • PPT 97-2003/english-with-jonnnik.ppt 401.9 kB
  • PPT 97-2003/expressing-future-will-be-going-to.ppt 2.9 MB
  • PPT 97-2003/extreme-sports.ppt 8.3 MB
  • PPT 97-2003/family-tree.ppt 704.5 kB
  • PPT 97-2003/family-vocab-begin.ppt 5.2 MB
  • PPT 97-2003/family.ppt 1.3 MB
  • PPT 97-2003/family_001.ppt 581.6 kB
  • PPT 97-2003/famous-buildings.ppt 3.7 MB
  • PPT 97-2003/favorite-pett.ppt 1.3 MB
  • PPT 97-2003/favourite-english-holidays.ppt 3.0 MB
  • PPT 97-2003/feelings-poster.ppt 1.4 MB
  • PPT 97-2003/feelings.ppt 1.7 MB
  • PPT 97-2003/feelings_001.ppt 484.4 kB
  • PPT 97-2003/festivals.ppt 3.6 MB
  • PPT 97-2003/first-conditional-lesson.ppt 952.3 kB
  • PPT 97-2003/first-conditional.ppt 1.6 MB
  • PPT 97-2003/first-conditional_001.ppt 1.7 MB
  • PPT 97-2003/first-conditional_002.ppt 778.8 kB
  • PPT 97-2003/first-conditional_003.ppt 2.5 MB
  • PPT 97-2003/florence-and-the-machine.ppt 1.5 MB
  • PPT 97-2003/food-activity.ppt 3.5 MB
  • PPT 97-2003/food-powerpoint.ppt 1.8 MB
  • PPT 97-2003/food-pp.ppt 980.0 kB
  • PPT 97-2003/food-vocabularyspeaking-cards.ppt 1.0 MB
  • PPT 97-2003/food1.ppt 3.3 MB
  • PPT 97-2003/for-since-or-ago.ppt 1.6 MB
  • PPT 97-2003/forrest-gump.ppt 5.4 MB
  • PPT 97-2003/free-time-activites-1.ppt 998.4 kB
  • PPT 97-2003/free-time-activities-2.ppt 1.4 MB
  • PPT 97-2003/friends.ppt 3.4 MB
  • PPT 97-2003/fruit-acabar.ppt 1.9 MB
  • PPT 97-2003/fruits-boardgame.ppt 898.0 kB
  • PPT 97-2003/FRUITS_BOARDGAME.ppt 896.0 kB
  • PPT 97-2003/future-forms-in-english.ppt 1.3 MB
  • PPT 97-2003/future-tenses.ppt 2.3 MB
  • PPT 97-2003/future-will.ppt 2.1 MB
  • PPT 97-2003/gerund-vs-invinitive.ppt 373.8 kB
  • PPT 97-2003/girl-with-poster.ppt 829.4 kB
  • PPT 97-2003/giving-instructions.ppt 466.4 kB
  • PPT 97-2003/giving-personal-information.ppt 1.3 MB
  • PPT 97-2003/global-issues2.ppt 3.8 MB
  • PPT 97-2003/going-out-to-eat-2003.ppt 4.8 MB
  • PPT 97-2003/grammar-revision.ppt 79.9 kB
  • PPT 97-2003/groups-of-animals.ppt 866.8 kB
  • PPT 97-2003/guess-the-job.ppt 115.2 kB
  • PPT 97-2003/halloween-game.ppt 1.7 MB
  • PPT 97-2003/halloween-myths-.ppt 1.2 MB
  • PPT 97-2003/halloween-vs-bonfire-night.ppt 847.4 kB
  • PPT 97-2003/halloween.ppt 1.5 MB
  • PPT 97-2003/hat-are-they-wearing-gtame.ppt 1.2 MB
  • PPT 97-2003/have-or-has.ppt 1.2 MB
  • PPT 97-2003/health.ppt 62.5 kB
  • PPT 97-2003/hello-and-goodbye.ppt 4.1 MB
  • PPT 97-2003/high-tall.ppt 376.3 kB
  • PPT 97-2003/hobbies-present-continuous.ppt 1.1 MB
  • PPT 97-2003/hobbies.ppt 3.2 MB
  • PPT 97-2003/hobbies_001.ppt 5.5 MB
  • PPT 97-2003/hot-cross-buns.ppt 1.6 MB
  • PPT 97-2003/house.ppt 747.0 kB
  • PPT 97-2003/housing-types-in-the-uk.ppt 4.3 MB
  • PPT 97-2003/how-are-you-feeling.ppt 2.4 MB
  • PPT 97-2003/how-long.ppt 1.2 MB
  • PPT 97-2003/how-old-are-they.ppt 1.9 MB
  • PPT 97-2003/how-to-write-a-story.ppt 1.4 MB
  • PPT 97-2003/how-to-write-emails-in-english.ppt 694.8 kB
  • PPT 97-2003/howmuch.ppt 4.8 MB
  • PPT 97-2003/if-clauses-1st-and-2nd-types.ppt 1.3 MB
  • PPT 97-2003/if-clauses-1st-and-2nd-types_001.ppt 1.4 MB
  • PPT 97-2003/if-clauses.ppt 1.8 MB
  • PPT 97-2003/If_Clauses.ppt 1.8 MB
  • PPT 97-2003/If_Clauses_001.ppt 1.8 MB
  • PPT 97-2003/ill-do-it.ppt 1.3 MB
  • PPT 97-2003/in-a-restaurant_complaint.ppt 3.6 MB
  • PPT 97-2003/in-my-laundry-room.ppt 358.4 kB
  • PPT 97-2003/in-the-restaurant.ppt 252.9 kB
  • PPT 97-2003/in-the-town.ppt 3.9 MB
  • PPT 97-2003/indefinite-pronoun.ppt 1.4 MB
  • PPT 97-2003/indefinite-pronoun_001.ppt 925.7 kB
  • PPT 97-2003/infantry-weapons.ppt 943.6 kB
  • PPT 97-2003/information-questions.ppt 4.8 MB
  • PPT 97-2003/intro-b-unit-16-object-pronouns.ppt 528.4 kB
  • PPT 97-2003/intro-b-unit-16-prepositions.ppt 669.7 kB
  • PPT 97-2003/introduce-yourself.ppt 2.0 MB
  • PPT 97-2003/introducing-sports-play_do_go.ppt 1.4 MB
  • PPT 97-2003/inventions-past-forms-expressing-opinion.ppt 4.2 MB
  • PPT 97-2003/irregular-verbs-infinite.ppt 3.7 MB
  • PPT 97-2003/irregular-verbs.ppt 118.8 kB
  • PPT 97-2003/job.ppt 242.2 kB
  • PPT 97-2003/jobs-game.ppt 2.0 MB
  • PPT 97-2003/jobs.ppt 1.7 MB
  • PPT 97-2003/jobs_001.ppt 812.5 kB
  • PPT 97-2003/jobs_002.ppt 3.8 MB
  • PPT 97-2003/jobs_003.ppt 685.6 kB
  • PPT 97-2003/jobs_powerpoint.ppt 669.7 kB
  • PPT 97-2003/jobssajt.ppt 3.3 MB
  • PPT 97-2003/july-4th-menu.ppt 1.2 MB
  • PPT 97-2003/kiev-sightseeing-j.ppt 6.0 MB
  • PPT 97-2003/ladygaga.ppt 3.0 MB
  • PPT 97-2003/lets-compare-people.ppt 1.8 MB
  • PPT 97-2003/lets-go-shopping.ppt 371.7 kB
  • PPT 97-2003/linking-words-activity.ppt 231.9 kB
  • PPT 97-2003/linking-words.ppt 1.6 MB
  • PPT 97-2003/linking-words_001.ppt 1.6 MB
  • PPT 97-2003/linking.ppt 772.6 kB
  • PPT 97-2003/linking_001.ppt 1.6 MB
  • PPT 97-2003/listening-zombie.ppt 1.2 MB
  • PPT 97-2003/lord-of-the-rings-pp-presentation.ppt 192.0 kB
  • PPT 97-2003/making-invitations.ppt 113.7 kB
  • PPT 97-2003/marking-punctuation.ppt 761.3 kB
  • PPT 97-2003/mass-media-game.ppt 372.7 kB
  • PPT 97-2003/may.ppt 3.0 MB
  • PPT 97-2003/means-of-transport.ppt 1.4 MB
  • PPT 97-2003/means-of-transport_001.ppt 1.5 MB
  • PPT 97-2003/milioneryz-sport.ppt 1.0 MB
  • PPT 97-2003/milioneryz-sport_001.ppt 1.3 MB
  • PPT 97-2003/millionaire-game-template.ppt 872.4 kB
  • PPT 97-2003/modal-and-semi-modal-verbs.ppt 4.3 MB
  • PPT 97-2003/modal-verbs.ppt 1.6 MB
  • PPT 97-2003/months-flashcards.ppt 500.7 kB
  • PPT 97-2003/months-of-the-year.ppt 1.6 MB
  • PPT 97-2003/mothers-day-poem.ppt 238.6 kB
  • PPT 97-2003/movie-sherlock-holmes.ppt 616.4 kB
  • PPT 97-2003/mr.ppt 90.6 kB
  • PPT 97-2003/much-many-a-lot-of.ppt 2.0 MB
  • PPT 97-2003/much.ppt 1.9 MB
  • PPT 97-2003/musical-instruments-and-present-simple-97.ppt 2.0 MB
  • PPT 97-2003/musical-instruments-and-present-simple-97_001.ppt 2.1 MB
  • PPT 97-2003/must.ppt 1.7 MB
  • PPT 97-2003/my-bedroom-prepositions-and-furniture.ppt 727.0 kB
  • PPT 97-2003/nationality.ppt 1.9 MB
  • PPT 97-2003/natual-and-human-landscapes.ppt 8.3 MB
  • PPT 97-2003/noun-modifiers.ppt 2.3 MB
  • PPT 97-2003/numbers-1-10.ppt 1.5 MB
  • PPT 97-2003/numbers-1-10_001.ppt 1.2 MB
  • PPT 97-2003/numbers-1-12.ppt 4.5 MB
  • PPT 97-2003/numbers-1.ppt 990.7 kB
  • PPT 97-2003/numbers-game.ppt 934.9 kB
  • PPT 97-2003/occupation.ppt 3.2 MB
  • PPT 97-2003/occupations-1.ppt 9.1 MB
  • PPT 97-2003/op.ppt 766.0 kB
  • PPT 97-2003/opposite-adjectives2.ppt 1.4 MB
  • PPT 97-2003/our-body-game.ppt 725.0 kB
  • PPT 97-2003/our-five-senses.ppt 472.6 kB
  • PPT 97-2003/passive_2012.ppt 1.3 MB
  • PPT 97-2003/password-food.ppt 2.1 MB
  • PPT 97-2003/past-continuous.ppt 1.9 MB
  • PPT 97-2003/past-simple-game.ppt 1.9 MB
  • PPT 97-2003/past-simple-pp.ppt 1.9 MB
  • PPT 97-2003/past-simple-present-perfect.ppt 175.1 kB
  • PPT 97-2003/past-simple-present-perfect_001.ppt 196.6 kB
  • PPT 97-2003/past-simple-tense2.ppt 208.9 kB
  • PPT 97-2003/past-simple-to-be-1.ppt 627.2 kB
  • PPT 97-2003/past-simple-to-be-2.ppt 814.1 kB
  • PPT 97-2003/past-simple-vs-past-continuous.ppt 2.0 MB
  • PPT 97-2003/past-simple.ppt 8.0 MB
  • PPT 97-2003/patterns.ppt 1.7 MB
  • PPT 97-2003/personal-ok.ppt 2.9 MB
  • PPT 97-2003/peters-family-game.ppt 1.4 MB
  • PPT 97-2003/peters-family1.ppt 720.4 kB
  • PPT 97-2003/photos-as-food-for-thought.ppt 318.5 kB
  • PPT 97-2003/phrasal-verbs.ppt 1.3 MB
  • PPT 97-2003/physical-appearance.ppt 4.1 MB
  • PPT 97-2003/places-in-the-city.ppt 2.1 MB
  • PPT 97-2003/plural-of-nouns-lesson-with-sound.ppt 1.9 MB
  • PPT 97-2003/pose-a-question-to.ppt 2.7 MB
  • PPT 97-2003/possessive-determiners.ppt 1.6 MB
  • PPT 97-2003/power.ppt 1.4 MB
  • PPT 97-2003/prepositional-verbs.ppt 1.2 MB
  • PPT 97-2003/prepositions-ii.ppt 1.2 MB
  • PPT 97-2003/prepositions-of-movement.ppt 1.2 MB
  • PPT 97-2003/prepositions-of-time.ppt 1.1 MB
  • PPT 97-2003/prepositions-of-time_001.ppt 1.5 MB
  • PPT 97-2003/prepositions.ppt 1.6 MB
  • PPT 97-2003/prepositionsoftime.ppt 2.1 MB
  • PPT 97-2003/present-cont-t.ppt 803.8 kB
  • PPT 97-2003/present-continuous-final.ppt 2.8 MB
  • PPT 97-2003/present-continuous-pictures-sports.ppt 3.8 MB
  • PPT 97-2003/present-continuous.ppt 1.0 MB
  • PPT 97-2003/present-continuous_001.ppt 1.0 MB
  • PPT 97-2003/present-perfect-london.ppt 4.7 MB
  • PPT 97-2003/present-perfect.ppt 1.2 MB
  • PPT 97-2003/present-simple-and-continuous.ppt 81.9 kB
  • PPT 97-2003/present-simple-negative.ppt 1.1 MB
  • PPT 97-2003/present-simple-versus-present-continuous.ppt 1.1 MB
  • PPT 97-2003/present-simple-vs-present-continuous.ppt 1.4 MB
  • PPT 97-2003/present-simple.ppt 1.9 MB
  • PPT 97-2003/present-simple_001.ppt 1.9 MB
  • PPT 97-2003/present-simple_002.ppt 1.8 MB
  • PPT 97-2003/present-simple_003.ppt 1.9 MB
  • PPT 97-2003/presentaci243n-bathroom.ppt 399.4 kB
  • PPT 97-2003/presentaci243n-bedrooms.ppt 1.0 MB
  • PPT 97-2003/presentaci243n1.ppt 536.1 kB
  • PPT 97-2003/presentation-future_upper-int.ppt 864.3 kB
  • PPT 97-2003/question-tags.ppt 600.6 kB
  • PPT 97-2003/question-tags_001.ppt 1.3 MB
  • PPT 97-2003/question-tags_002.ppt 94.7 kB
  • PPT 97-2003/question-words.ppt 1.7 MB
  • PPT 97-2003/question-words_001.ppt 1.3 MB
  • PPT 97-2003/questions.ppt 1.2 MB
  • PPT 97-2003/quiz-the-united-kingdom-of-great-britain.ppt 661.0 kB
  • PPT 97-2003/ra-bellthat-1.ppt 207.9 kB
  • PPT 97-2003/recipe.ppt 3.0 MB
  • PPT 97-2003/relative-clauses.ppt 294.4 kB
  • PPT 97-2003/reported-questions-2003.ppt 1.3 MB
  • PPT 97-2003/reported-speech-ppt.ppt 2.9 MB
  • PPT 97-2003/reported-speech-presentation.ppt 379.9 kB
  • PPT 97-2003/reported-speech.ppt 1.3 MB
  • PPT 97-2003/reported-speech_001.ppt 1.9 MB
  • PPT 97-2003/reported-speech_002.ppt 1.4 MB
  • PPT 97-2003/reported-speech_003.ppt 4.1 MB
  • PPT 97-2003/reported-statements-commands-and-requests.ppt 1.2 MB
  • PPT 97-2003/resimler.ppt 447.5 kB
  • PPT 97-2003/riddles-kopiya.ppt 1.5 MB
  • PPT 97-2003/roald-dahl-1916-1990.ppt 2.8 MB
  • PPT 97-2003/scholl-supplies-new.ppt 1.9 MB
  • PPT 97-2003/school-object.ppt 837.1 kB
  • PPT 97-2003/school-subjects-ppt.ppt 1.1 MB
  • PPT 97-2003/school-supplies.ppt 1.2 MB
  • PPT 97-2003/school.ppt 7.4 MB
  • PPT 97-2003/seal-english.ppt 1.9 MB
  • PPT 97-2003/season-postcard.ppt 1.0 MB
  • PPT 97-2003/seasons-pictures.ppt 3.6 MB
  • PPT 97-2003/shops.ppt 821.8 kB
  • PPT 97-2003/shops_001.ppt 1.4 MB
  • PPT 97-2003/should.ppt 119.3 kB
  • PPT 97-2003/should_001.ppt 5.2 MB
  • PPT 97-2003/similes.ppt 6.5 MB
  • PPT 97-2003/simple-past.ppt 2.0 MB
  • PPT 97-2003/simple-present-negative.ppt 411.1 kB
  • PPT 97-2003/singular-and-plural.ppt 1.6 MB
  • PPT 97-2003/small-talk-and-icebreakers.ppt 5.0 MB
  • PPT 97-2003/smile.ppt 298.0 kB
  • PPT 97-2003/some-nay.ppt 1.6 MB
  • PPT 97-2003/song-because-you-loved-me.ppt 250.9 kB
  • PPT 97-2003/sophies-town-99-h.ppt 1.9 MB
  • PPT 97-2003/sophies-town-99-h_001.ppt 1.8 MB
  • PPT 97-2003/spelling-ed-words.ppt 73.2 kB
  • PPT 97-2003/spelling-er-est-words.ppt 74.2 kB
  • PPT 97-2003/spelling-ing-words.ppt 75.8 kB
  • PPT 97-2003/sports-game-lesson.ppt 1.8 MB
  • PPT 97-2003/sports_vocab.ppt 4.0 MB
  • PPT 97-2003/sports_vocab_001.ppt 4.1 MB
  • PPT 97-2003/spring.ppt 2.8 MB
  • PPT 97-2003/st-nicholas-day.ppt 1.5 MB
  • PPT 97-2003/st-patrick.ppt 2.2 MB
  • PPT 97-2003/st-patrick_001.ppt 1.5 MB
  • PPT 97-2003/st-petersburg-sightseeing-tour.ppt 4.7 MB
  • PPT 97-2003/st.ppt 2.8 MB
  • PPT 97-2003/st_001.ppt 777.7 kB
  • PPT 97-2003/stepeni-sravneniya.ppt 2.8 MB
  • PPT 97-2003/stories.ppt 4.4 MB
  • PPT 97-2003/strange-food-around-the-world.ppt 3.3 MB
  • PPT 97-2003/summer.ppt 2.6 MB
  • PPT 97-2003/summer_001.ppt 1.4 MB
  • PPT 97-2003/summer_002.ppt 1.4 MB
  • PPT 97-2003/superlative_jeopardy-1.ppt 550.9 kB
  • PPT 97-2003/sushi.ppt 5.5 MB
  • PPT 97-2003/symptoms.ppt 367.6 kB
  • PPT 97-2003/tag-questions-time-race.ppt 267.3 kB
  • PPT 97-2003/talk-for-a-minute.ppt 1.8 MB
  • PPT 97-2003/talking-about-what-people-are-doing-present.ppt 2.6 MB
  • PPT 97-2003/tell-or-say.ppt 116.2 kB
  • PPT 97-2003/telling-time.ppt 1.2 MB
  • PPT 97-2003/tenses-chart-for-classroom.ppt 925.2 kB
  • PPT 97-2003/the-alphabet.ppt 1.2 MB
  • PPT 97-2003/the-body-digital-whiteboard.ppt 634.9 kB
  • PPT 97-2003/the-dog-is.ppt 397.3 kB
  • PPT 97-2003/the-environment-re-use-objects.ppt 6.9 MB
  • PPT 97-2003/the-flintstones-ppt.ppt 1.8 MB
  • PPT 97-2003/the-past-simple-presentation2.ppt 604.2 kB
  • PPT 97-2003/the-polite-robber-reported-speech-powerpoint.ppt 379.4 kB
  • PPT 97-2003/the-present-perfect-tense.ppt 1.2 MB
  • PPT 97-2003/the-present-simple-1.ppt 710.7 kB
  • PPT 97-2003/the-present-simple-2.ppt 1.1 MB
  • PPT 97-2003/the-system-of-education.ppt 1.6 MB
  • PPT 97-2003/the-very-hungry-caterpillar-ppt.ppt 837.1 kB
  • PPT 97-2003/the-weather.ppt 1.9 MB
  • PPT 97-2003/The_passive_2012.ppt 2.0 MB
  • PPT 97-2003/The_passive_2012_001.ppt 2.0 MB
  • PPT 97-2003/therainbowfish.ppt 1.1 MB
  • PPT 97-2003/third-conditional.ppt 898.6 kB
  • PPT 97-2003/this-is-my-house-5.ppt 875.5 kB
  • PPT 97-2003/time.ppt 861.7 kB
  • PPT 97-2003/to-be1.ppt 4.3 MB
  • PPT 97-2003/too-much-too-many.ppt 1.8 MB
  • PPT 97-2003/tools_basic.ppt 445.4 kB
  • PPT 97-2003/tourjeop.ppt 767.0 kB
  • PPT 97-2003/transportation.ppt 570.4 kB
  • PPT 97-2003/tricky-questions.ppt 4.1 MB
  • PPT 97-2003/under-the-sea-ppt.ppt 5.1 MB
  • PPT 97-2003/unit-2-reporting-statements.ppt 1.9 MB
  • PPT 97-2003/unusuasl-houses.ppt 3.8 MB
  • PPT 97-2003/valentine-game.ppt 1.3 MB
  • PPT 97-2003/verb-to-be-revision.ppt 1.7 MB
  • PPT 97-2003/verb-to-be-simple-past.ppt 2.0 MB
  • PPT 97-2003/verb-to-be-simple-past_001.ppt 1.2 MB
  • PPT 97-2003/verb-to-be.ppt 1.3 MB
  • PPT 97-2003/verb-to-be_001.ppt 3.0 MB
  • PPT 97-2003/verbe-cl.ppt 482.3 kB
  • PPT 97-2003/vocab-weather-season-camping.ppt 3.1 MB
  • PPT 97-2003/voprosy-legkie.ppt 644.1 kB
  • PPT 97-2003/w5h-questions.ppt 935.4 kB
  • PPT 97-2003/weather-poster.ppt 326.7 kB
  • PPT 97-2003/weather-wheel-poster.ppt 710.1 kB
  • PPT 97-2003/webquest-modal-verbs-ppt.ppt 5.1 MB
  • PPT 97-2003/wh-questions-and-answers.ppt 1.8 MB
  • PPT 97-2003/what-are-they-doing-1.ppt 1.1 MB
  • PPT 97-2003/what-are-they-doing-2.ppt 823.8 kB
  • PPT 97-2003/what-are-they-doing-now.ppt 758.8 kB
  • PPT 97-2003/what-are-they-doing_present-contninous.ppt 2.5 MB
  • PPT 97-2003/what-are-they-wearing-2.ppt 6.3 MB
  • PPT 97-2003/what-can-you-find-in-your-bedroom.ppt 863.7 kB
  • PPT 97-2003/what-do-they-do-in-their-free-time.ppt 1.8 MB
  • PPT 97-2003/what-do-they-normally-do1.ppt 2.3 MB
  • PPT 97-2003/what-do-you-do-in-class.ppt 856.1 kB
  • PPT 97-2003/what-have-they-got.ppt 4.7 MB
  • PPT 97-2003/what-werethey-doing.ppt 1.3 MB
  • PPT 97-2003/where-do-you-live.ppt 1.1 MB
  • PPT 97-2003/where-is-mark.ppt 421.9 kB
  • PPT 97-2003/who-wants-2-be.ppt 1.9 MB
  • PPT 97-2003/who-wants-to-be-a-millionaire-1.ppt 2.6 MB
  • PPT 97-2003/wild-animals-description.ppt 380.4 kB
  • PPT 97-2003/wish-past.ppt 936.4 kB
  • PPT 97-2003/wishes-and-regrets.ppt 83.5 kB
  • PPT 97-2003/word-head.ppt 923.6 kB
  • PPT 97-2003/word-learning-strategies-manatv.ppt 2.1 MB
  • PPT 97-2003/word-stress-and-word-stress-in-the-sentence.ppt 1.5 MB
  • PPT 97-2003/worksheet_lozitskaya_liubov.ppt 83.5 kB
  • PPT 97-2003/writing-diversity.ppt 923.1 kB
  • PPT 97-2003/x-mas-quiz.ppt 6.5 MB
  • PPT 97-2003/yoyoyoyoyo.ppt 3.9 MB
  • PPT/1c-foods-and-their-origins.pptx 982.8 kB
  • PPT/2-b-famous-families.pptx 3.7 MB
  • PPT/5th-has-vs-have-grammar-sheet-to-share.pptx 60.7 kB
  • PPT/a-any-some.pptx 9.0 MB
  • PPT/a-mirror-before-your-very-eyes.pptx 1.8 MB
  • PPT/adverbsfrequency.pptx 466.9 kB
  • PPT/advertising-techniques.pptx 1.7 MB
  • PPT/ai-and-i.pptx 88.1 kB
  • PPT/alphabet-ppt.pptx 1.3 MB
  • PPT/american-high-schools.pptx 3.9 MB
  • PPT/animal-classes.pptx 457.7 kB
  • PPT/be-get-used-to-would.pptx 835.4 kB
  • PPT/biscuits-shapes.pptx 3.3 MB
  • PPT/british-holidays.pptx 4.0 MB
  • PPT/can-cant-to_express_ability.pptx 357.7 kB
  • PPT/can-cant.pptx 357.6 kB
  • PPT/category-game.pptx 3.3 MB
  • PPT/ch-18-complements.pptx 576.2 kB
  • PPT/changes.pptx 2.5 MB
  • PPT/character.pptx 1.2 MB
  • PPT/chores-speaking-activity.pptx 266.7 kB
  • PPT/clauses.pptx 181.1 kB
  • PPT/clothes.pptx 2.0 MB
  • PPT/colours-adj.pptx 629.6 kB
  • PPT/comp-sup.pptx 2.8 MB
  • PPT/comparative-adjactives-presentation.pptx 1.9 MB
  • PPT/conditional-sentences.pptx 52.0 kB
  • PPT/countable-and-uncountable-nouns02.pptx 160.5 kB
  • PPT/countable-and-uncountable.pptx 309.5 kB
  • PPT/crime.pptx 182.1 kB
  • PPT/daily-routine-chart.pptx 1.4 MB
  • PPT/debate-topics.pptx 49.8 kB
  • PPT/definite-and-indefinite-articles.pptx 171.2 kB
  • PPT/describing-houses.pptx 2.1 MB
  • PPT/do-you-want-some-more.pptx 639.8 kB
  • PPT/dont-lesson.pptx 1.6 MB
  • PPT/doua-grammar.pptx 288.1 kB
  • PPT/draw-a-picture.pptx 215.7 kB
  • PPT/each-vs-every.pptx 92.1 kB
  • PPT/elmos-guessing-game-book-ppp.pptx 356.3 kB
  • PPT/english-quiz-en.pptx 1.1 MB
  • PPT/enjoying-your-home.pptx 827.1 kB
  • PPT/every-day-activities-3my.pptx 1.0 MB
  • PPT/expressions_of_quantity.pptx 78.7 kB
  • PPT/fairy-tales-submit.pptx 3.6 MB
  • PPT/family-tree-4-printing.pptx 392.1 kB
  • PPT/family1.pptx 1.1 MB
  • PPT/famous-5a.pptx 1.3 MB
  • PPT/famous-landmarks-in-india.pptx 5.0 MB
  • PPT/famous-movie-quotes-part-1-reported-speech.pptx 7.1 MB
  • PPT/famous-movie-quotes-part-2-reported-speech.pptx 8.5 MB
  • PPT/favorite-fruits.pptx 849.6 kB
  • PPT/feelings.pptx 415.3 kB
  • PPT/flash-cards_plural.pptx 1.5 MB
  • PPT/flowers.pptx 2.7 MB
  • PPT/food-containers.pptx 2.2 MB
  • PPT/food-idioms.pptx 787.4 kB
  • PPT/food_idioms.pptx 787.4 kB
  • PPT/football-quiz.pptx 1.0 MB
  • PPT/fragments-run-on.pptx 3.0 MB
  • PPT/fruit.pptx 1.2 MB
  • PPT/fullbreakfast.pptx 1.7 MB
  • PPT/future-forms.pptx 641.3 kB
  • PPT/geographyoftheusa.pptx 1.3 MB
  • PPT/gerund-and-infinitive.pptx 88.8 kB
  • PPT/grade-3-lesson-1.pptx 4.3 MB
  • PPT/greeting.pptx 702.9 kB
  • PPT/gtky-magazine-covers.pptx 6.4 MB
  • PPT/habits-for-children-final.pptx 1.5 MB
  • PPT/home-remedies.pptx 893.0 kB
  • PPT/household-chores-simple-present-tense.pptx 101.5 kB
  • PPT/household-chores-simple-reading.pptx 526.8 kB
  • PPT/i-live-inon.pptx 422.7 kB
  • PPT/idioms-with-parts-of-the-body.pptx 452.4 kB
  • PPT/idioms.pptx 1.2 MB
  • PPT/imperatives-and-advices.pptx 337.0 kB
  • PPT/infinitive-of-purpose.pptx 55.5 kB
  • PPT/interesting-cultural-facts-echo-questions.pptx 1.8 MB
  • PPT/jane-austen-2.pptx 3.1 MB
  • PPT/jeopardy.pptx 1.0 MB
  • PPT/kitchen-utensils.pptx 781.8 kB
  • PPT/lesson-3-passive-voice.pptx 3.3 MB
  • PPT/like-dislike.pptx 3.7 MB
  • PPT/like.pptx 78.4 kB
  • PPT/linkers-of-contrast-p70.pptx 291.3 kB
  • PPT/linking-words-activity.pptx 119.6 kB
  • PPT/london-quiz-pp.pptx 3.2 MB
  • PPT/london.pptx 70.1 kB
  • PPT/london_001.pptx 1.2 MB
  • PPT/modal-verbs-have-to-ought.pptx 1.9 MB
  • PPT/moonshadow-and-superstitions-first-conditional.pptx 1.7 MB
  • PPT/movies-vocabulary.pptx 2.3 MB
  • PPT/narrative-tenses.pptx 240.8 kB
  • PPT/new-manners-1.pptx 1.1 MB
  • PPT/new-york.pptx 1.9 MB
  • PPT/nouns-plural-boardgame.pptx 4.2 MB
  • PPT/nouns.pptx 60.7 kB
  • PPT/number-and-vocab-practice-shared.pptx 542.1 kB
  • PPT/numbers.pptx 2.5 MB
  • PPT/paralympicsnew.pptx 3.7 MB
  • PPT/parts-of-the-body.pptx 2.1 MB
  • PPT/passive-voice.pptx 74.4 kB
  • PPT/passive-voice_001.pptx 74.7 kB
  • PPT/past-and-past-love-wh-questions-marie-andr233.pptx 963.3 kB
  • PPT/past-continuous-tense2.pptx 460.3 kB
  • PPT/past-experiences.pptx 153.6 kB
  • PPT/past-experiences_001.pptx 153.6 kB
  • PPT/phrasalverbdown.pptx 45.5 kB
  • PPT/phrasalverbsup.pptx 55.5 kB
  • PPT/places-adj.pptx 723.4 kB
  • PPT/placesaroundtown.pptx 2.3 MB
  • PPT/power-point-family-the-simpsons.pptx 590.6 kB
  • PPT/ppt-circus.pptx 946.7 kB
  • PPT/ppt-presentatie.pptx 640.5 kB
  • PPT/prefixes-and-suffixes.pptx 91.7 kB
  • PPT/preposition-power-place.pptx 1.0 MB
  • PPT/prepositions.pptx 325.5 kB
  • PPT/present-continuous-and-present-simple-for-the.pptx 358.3 kB
  • PPT/present-perfect-tense.pptx 360.9 kB
  • PPT/present-perfect-vs-simple-past.pptx 201.1 kB
  • PPT/present-perfect-well-explained.pptx 1.1 MB
  • PPT/present-simple-powerpoint-presentation.pptx 597.8 kB
  • PPT/present-simple-tense.pptx 335.4 kB
  • PPT/present-simple.pptx 421.0 kB
  • PPT/present-simple_001.pptx 221.2 kB
  • PPT/PRESENT_PERFECT_WELL_EXPLAINED_in_English_.pptx 1.1 MB
  • PPT/presentaci243n1.pptx 143.4 kB
  • PPT/presentation-party-lesson.pptx 1.6 MB
  • PPT/prostitution.pptx 91.6 kB
  • PPT/regular-verbs-spelling-rules.pptx 83.1 kB
  • PPT/reported-speech.pptx 1.3 MB
  • PPT/revision-time.pptx 484.2 kB
  • PPT/roleplaying.pptx 52.6 kB
  • PPT/saint-patricks-day.pptx 718.3 kB
  • PPT/Saint_Patrick_s_Day_corrected_version.pptx 718.3 kB
  • PPT/Saint_Patrick_s_Day_corrected_version_001.pptx 718.3 kB
  • PPT/save-the-world.pptx 826.7 kB
  • PPT/school-objects.pptx 1.7 MB
  • PPT/school-supplies-2.pptx 1.0 MB
  • PPT/school-supplies.pptx 948.2 kB
  • PPT/seasons.pptx 4.0 MB
  • PPT/seasons_001.pptx 1.8 MB
  • PPT/simple-present-3c.pptx 76.9 kB
  • PPT/simpsons.pptx 3.4 MB
  • PPT/some-common-errors-busyteacher.pptx 1.5 MB
  • PPT/some-common-errors-partii-busyteacher.pptx 562.2 kB
  • PPT/some-music-oct-2012.pptx 710.4 kB
  • PPT/sorting-out-animals.pptx 900.7 kB
  • PPT/speaking-activity_modal-auxiliary-verbs.pptx 120.4 kB
  • PPT/speaking-activity_modal-auxiliary-verbs_001.pptx 121.7 kB
  • PPT/speaking-yes-no-answers-whats-is-this.pptx 7.8 MB
  • PPT/spelling-mnemonics-busyteacher.pptx 157.6 kB
  • PPT/state-vs-action.pptx 1.7 MB
  • PPT/stereotypes.pptx 483.8 kB
  • PPT/stpatricksdaypowerpoint.pptx 8.6 MB
  • PPT/teaching-may-i-vs.pptx 415.1 kB
  • PPT/telling-the-time.pptx 760.5 kB
  • PPT/the-alphabet.pptx 3.1 MB
  • PPT/the-definite-article.pptx 315.6 kB
  • PPT/the-office-present-continuous.pptx 3.5 MB
  • PPT/the-old-witch-ppp.pptx 261.3 kB
  • PPT/the-price-is-right.pptx 1.3 MB
  • PPT/the-princess-and-the-frog.pptx 158.3 kB
  • PPT/the-renaissance-in-britain.pptx 1.7 MB
  • PPT/the-simpsons-family-tree.pptx 2.1 MB
  • PPT/the-very-hungry-caterpillar-book-ppp.pptx 977.7 kB
  • PPT/the-very-hungry-caterpillar-book-ppp_001.pptx 977.9 kB
  • PPT/thecity.pptx 3.9 MB
  • PPT/this-these-that-those.pptx 106.2 kB
  • PPT/timepresentation.pptx 1.0 MB
  • PPT/vegetables-matching-word-and-picture.pptx 692.5 kB
  • PPT/verb-to-be-contest.pptx 64.9 kB
  • PPT/weather.pptx 1.1 MB
  • PPT/what-are-they-wearing-2.pptx 2.8 MB
  • PPT/what-are-you-doing.pptx 1.3 MB
  • PPT/what-did-you-do-wksht-shared.pptx 126.6 kB
  • PPT/what-food-do-you-like.pptx 2.1 MB
  • PPT/what-happens-next.pptx 97.8 kB
  • PPT/what-were-your-favorite-games-when-u-were-a-child.pptx 2.8 MB
  • PPT/whats-your-favorite-food.pptx 284.2 kB
  • PPT/will_going_to.pptx 144.1 kB
  • PPT/worksheet-2.pptx 2.8 MB
  • PPT/zapovednacparkzoosaf.pptx 1.4 MB
  • RAR/1984.rar 270.3 kB
  • RAR/1984_001.rar 270.3 kB
  • RAR/adjectives_with_suffixless.rar 80.6 kB
  • RAR/adjectives_with_suffixless_001.rar 80.6 kB
  • RAR/all_i_want_for_christmas.rar 125.1 kB
  • RAR/all_i_want_for_christmas_001.rar 125.1 kB
  • RAR/analogies.rar 194.3 kB
  • RAR/animals.rar 3.7 MB
  • RAR/australia.rar 32.4 kB
  • RAR/back-to-high-school-pack.rar 1.3 MB
  • RAR/back-to-primary-school-pack.rar 2.0 MB
  • RAR/back-to-secondary-school.rar 2.0 MB
  • RAR/because-of-you.rar 8.7 MB
  • RAR/being_a_celebritypros__cons.rar 45.8 kB
  • RAR/being_a_celebritypros__cons_001.rar 45.8 kB
  • RAR/busyteacher-org-essays.rar 146.7 kB
  • RAR/busyteacher-org-sound-effects.rar 49.4 MB
  • RAR/cae_documents.rar 2.3 MB
  • RAR/cae_documents_001.rar 2.3 MB
  • RAR/certificates4busyteacher.rar 6.3 MB
  • RAR/christmas-new-year-images.rar 11.1 MB
  • RAR/classroomlabels.rar 495.3 kB
  • RAR/cluster_buster_game.rar 218.0 kB
  • RAR/cluster_buster_game_001.rar 218.0 kB
  • RAR/cupid-solution.rar 173.0 kB
  • RAR/disney.rar 1.1 MB
  • RAR/dont_have_to_vs.rar 52.4 kB
  • RAR/dont_have_to_vs_001.rar 52.4 kB
  • RAR/drug-abuse-education-skillbook.rar 9.9 MB
  • RAR/easter.rar 2.2 MB
  • RAR/energy-extra-materials.rar 6.7 MB
  • RAR/English-Flashcards.rar 21.1 MB
  • RAR/english-in-mind-activities.rar 2.5 MB
  • RAR/fairytales1.rar 9.1 MB
  • RAR/fairytales2.rar 8.7 MB
  • RAR/fairytales3.rar 6.4 MB
  • RAR/fairytales4.rar 2.5 MB
  • RAR/fathers-day.rar 797.8 kB
  • RAR/gamefiles.rar 84.8 kB
  • RAR/gamefiles_001.rar 84.8 kB
  • RAR/general-tests-intermediate.rar 41.0 kB
  • RAR/gorilla-mountain-worksheet.rar 1.9 MB
  • RAR/hear_see_make__bare_inf.rar 43.6 kB
  • RAR/hear_see_make__bare_inf_001.rar 43.6 kB
  • RAR/independence.rar 584.4 kB
  • RAR/inside_out.rar 1.4 MB
  • RAR/inside_out_001.rar 1.4 MB
  • RAR/ipa-fonts.rar 90.1 kB
  • RAR/irreg-verbs.rar 11.7 kB
  • RAR/isarethereworksheet.rar 13.5 kB
  • RAR/jb.rar 308.0 kB
  • RAR/listening-training_2.rar 1.7 MB
  • RAR/listening_training.rar 2.9 MB
  • RAR/masks.rar 383.5 kB
  • RAR/mday-coloring-cards.rar 5.3 MB
  • RAR/memorial-day.rar 219.0 kB
  • RAR/merry_christmas.rar 1.1 MB
  • RAR/merry_christmas_001.rar 1.1 MB
  • RAR/messages-extra-materials.rar 3.8 MB
  • RAR/mixed_conditionals.rar 81.4 kB
  • RAR/mixed_conditionals_001.rar 81.4 kB
  • RAR/mobiles.rar 1.4 MB
  • RAR/momsday-wordsearches.rar 1.0 MB
  • RAR/monopoly-print-materials.rar 3.7 MB
  • RAR/Mosquite_001.rar 1.6 kB
  • RAR/office1.rar 3.2 MB
  • RAR/past-simple-questions.rar 181.5 kB
  • RAR/phrasal_verbs_with_up.rar 111.5 kB
  • RAR/phrasal_verbs_with_up_001.rar 111.5 kB
  • RAR/plural.rar 16.6 kB
  • RAR/present-perfect.rar 167.7 kB
  • RAR/present_perfect_continuous.rar 106.6 kB
  • RAR/present_perfect_continuous_001.rar 106.6 kB
  • RAR/presperfect.rar 2.4 MB
  • RAR/projects.rar 2.8 MB
  • RAR/puppets.rar 469.5 kB
  • RAR/pyramid_game.rar 124.9 kB
  • RAR/pyramid_game_001.rar 124.9 kB
  • RAR/shop-clipart.rar 3.1 MB
  • RAR/silvalsur.rar 107.5 kB
  • RAR/slumdog-millionaire.rar 36.8 kB
  • RAR/songs.rar 26.1 MB
  • RAR/songs_001.rar 26.1 MB
  • RAR/spasibo_001.rar 1.6 kB
  • RAR/train-your-dragon.rar 33.4 MB
  • RAR/vancouver.rar 59.5 kB
  • RAR/vehicles.rar 1.6 MB
  • RAR/verbal-and-adjective-collocations-advanced.rar 52.3 kB
  • RAR/waving-flag.rar 5.5 MB
  • RAR/will_vs.rar 202.9 kB
  • RAR/will_vs_001.rar 202.9 kB
  • RAR/words-ending-with-and-beginning-with.rar 1.6 MB
  • RAR/worldcup2010.rar 4.1 MB
  • RAR/writing_basics.rar 117.5 kB
  • RAR/writing_basics_001.rar 117.5 kB
  • Word 97-2003/-_-.doc 133.6 kB
  • Word 97-2003/-ible-or-able.doc 59.9 kB
  • Word 97-2003/-s-ed.doc 27.1 kB
  • Word 97-2003/01-adele-someone-like-you-worksheet.doc 33.3 kB
  • Word 97-2003/0_reported_speech.doc 146.9 kB
  • Word 97-2003/1-16-shape-names.doc 21.0 kB
  • Word 97-2003/1-2-3-smiley-faces.doc 35.8 kB
  • Word 97-2003/1-2-conditionals.doc 811.0 kB
  • Word 97-2003/1-20-snakes-and-ladders.doc 162.3 kB
  • Word 97-2003/1-8-colours.doc 37.4 kB
  • Word 97-2003/1-net.doc 612.9 kB
  • Word 97-2003/1-prpastfut.doc 137.7 kB
  • Word 97-2003/1-satchin-patchikin.doc 80.9 kB
  • Word 97-2003/1-verb-to-be-board-gamepresent-simple-lk-1corrected.doc 50.2 kB
  • Word 97-2003/1-verb-to-be-board-gamepresent-simple-lk.doc 51.2 kB
  • Word 97-2003/1-verbtenses-chart.doc 37.4 kB
  • Word 97-2003/1.doc 24.1 kB
  • Word 97-2003/10-weird-traditions.doc 1.4 MB
  • Word 97-2003/10-weird-traditions_001.doc 1.4 MB
  • Word 97-2003/10c.doc 100.4 kB
  • Word 97-2003/10g.doc 296.4 kB
  • Word 97-2003/12-powerfulword-quiz.doc 28.2 kB
  • Word 97-2003/12-signs-of-the-zodiac-reformulado.doc 899.6 kB
  • Word 97-2003/12-tenses.doc 33.8 kB
  • Word 97-2003/17-pages-graded-dictations.doc 52.7 kB
  • Word 97-2003/1_001.doc 1.6 MB
  • Word 97-2003/1_002.doc 33.8 kB
  • Word 97-2003/1_003.doc 105.0 kB
  • Word 97-2003/1_1186teste1186p.doc 1.0 MB
  • Word 97-2003/1m-prueba-coef.doc 97.8 kB
  • Word 97-2003/1st-conditional-exerc.doc 1.5 MB
  • Word 97-2003/2-conditional.doc 170.5 kB
  • Word 97-2003/2-present-2-pasts-present-perfect.doc 44.0 kB
  • Word 97-2003/2.doc 2.0 MB
  • Word 97-2003/21_02_2011-simple-past.doc 367.6 kB
  • Word 97-2003/23as_reference_sheetha_comparing_contrasting_a_graph.doc 190.0 kB
  • Word 97-2003/23as_reference_sheetha_comparing_contrasting_a_graph_001.doc 190.0 kB
  • Word 97-2003/2_001.doc 45.1 kB
  • Word 97-2003/2_002.doc 64.0 kB
  • Word 97-2003/2b-vocab.doc 34.3 kB
  • Word 97-2003/2classroom-language.doc 166.9 kB
  • Word 97-2003/2maria-magdalena1.doc 75.3 kB
  • Word 97-2003/3-condit.doc 41.0 kB
  • Word 97-2003/3-little-birds-bob-marley.doc 39.4 kB
  • Word 97-2003/3-the-boy-who-cried.doc 52.7 kB
  • Word 97-2003/30-sec-talks.doc 97.8 kB
  • Word 97-2003/30_elementary_questions.doc 38.9 kB
  • Word 97-2003/3186c-2nd-term2012.doc 28.7 kB
  • Word 97-2003/32-most-important-email-etiquette-tips.doc 23.6 kB
  • Word 97-2003/3a-its-cold.doc 222.2 kB
  • Word 97-2003/3a-yl.doc 28.2 kB
  • Word 97-2003/3b-phrases-with-travel.doc 33.8 kB
  • Word 97-2003/3classroom-language.doc 84.0 kB
  • Word 97-2003/3d-conditional.doc 4.6 MB
  • Word 97-2003/3d-conditional_001.doc 4.6 MB
  • Word 97-2003/4-said-i-loved-you-but-i-lied.doc 638.0 kB
  • Word 97-2003/4-square-ws-21.doc 30.2 kB
  • Word 97-2003/4-square-ws-3.doc 24.6 kB
  • Word 97-2003/4-square-ws-4a.doc 24.1 kB
  • Word 97-2003/4-square-ws-4b.doc 24.1 kB
  • Word 97-2003/4-square-ws1.doc 21.5 kB
  • Word 97-2003/4.doc 249.3 kB
  • Word 97-2003/4186-a209o.doc 31.7 kB
  • Word 97-2003/47-character-qualitie.doc 24.6 kB
  • Word 97-2003/4_001.doc 38.4 kB
  • Word 97-2003/4atest.doc 174.6 kB
  • Word 97-2003/4kl-isemestr.doc 236.0 kB
  • Word 97-2003/4rd-bruno-mars-lazy-idioms.doc 22.0 kB
  • Word 97-2003/4tea_time__there_isare.doc 354.3 kB
  • Word 97-2003/4tea_time__there_isare_001.doc 354.3 kB
  • Word 97-2003/4thgradeexam2.doc 495.6 kB
  • Word 97-2003/5-alan.doc 117.2 kB
  • Word 97-2003/5.doc 34.3 kB
  • Word 97-2003/50-dates.doc 46.1 kB
  • Word 97-2003/5b-updated-green-card.doc 38.9 kB
  • Word 97-2003/5bas_ingles_001_sos.doc 334.3 kB
  • Word 97-2003/5bas_ingles_diag.doc 106.0 kB
  • Word 97-2003/5to_ingles_004.doc 454.7 kB
  • Word 97-2003/5to_ingles_retroalimentacion-unit-4.doc 672.8 kB
  • Word 97-2003/5to_inlges_writing-numbers-1-20.doc 1.6 MB
  • Word 97-2003/5tobas_ingles_002.doc 423.9 kB
  • Word 97-2003/5tobas_ingles_003.doc 1.2 MB
  • Word 97-2003/6-clues.doc 112.6 kB
  • Word 97-2003/6-minutes-english-arachnophobia.doc 34.8 kB
  • Word 97-2003/60-second-play.doc 24.6 kB
  • Word 97-2003/63-past-simple.doc 112.6 kB
  • Word 97-2003/6bas_ingles_-remedial-unit-3.doc 1.0 MB
  • Word 97-2003/6tobas_ingles_describing.doc 3.0 MB
  • Word 97-2003/7-7-british.doc 29.2 kB
  • Word 97-2003/7395229-simple-present-tense-worksheet-.doc 175.1 kB
  • Word 97-2003/7th-grades-level-test.doc 64.5 kB
  • Word 97-2003/8-the-spy-next-door.doc 100.4 kB
  • Word 97-2003/8-w305ll.doc 35.3 kB
  • Word 97-2003/8_.doc 30.2 kB
  • Word 97-2003/8b-7-homophones-to-two.doc 55.3 kB
  • Word 97-2003/8th-f.doc 85.5 kB
  • Word 97-2003/9-by-shane-acker.doc 248.3 kB
  • Word 97-2003/9-de-mayo-action-verb-cartoon.doc 205.8 kB
  • Word 97-2003/911-america-under-attack.doc 48.6 kB
  • Word 97-2003/93-million-miles-from-the-sun-easier-version.doc 109.1 kB
  • Word 97-2003/93-million-miles-song-activity.doc 75.8 kB
  • Word 97-2003/a-an-r.doc 135.2 kB
  • Word 97-2003/a-an-some-any-g.doc 43.0 kB
  • Word 97-2003/a-an-the.doc 2.8 MB
  • Word 97-2003/a-an.doc 116.2 kB
  • Word 97-2003/a-baby-on-the-bus.doc 36.4 kB
  • Word 97-2003/a-christmas-carol-video-comprehension-worksheet.doc 1.7 MB
  • Word 97-2003/a-day-in-the-life-beatles.doc 23.0 kB
  • Word 97-2003/a-day-out.doc 186.4 kB
  • Word 97-2003/a-friend.doc 338.4 kB
  • Word 97-2003/a-funny-dictation.doc 20.5 kB
  • Word 97-2003/a-ghost-story.doc 184.3 kB
  • Word 97-2003/a-gringo-in-madrid.doc 43.5 kB
  • Word 97-2003/a-guide-to-great-walls.doc 30.7 kB
  • Word 97-2003/a-job-interview.doc 26.1 kB
  • Word 97-2003/a-new-copy.doc 194.6 kB
  • Word 97-2003/a-new-mum-again.doc 37.4 kB
  • Word 97-2003/a-new-mum-again_001.doc 33.8 kB
  • Word 97-2003/a-test-for-elementary-level.doc 40.4 kB
  • Word 97-2003/a-typical-day.doc 93.2 kB
  • Word 97-2003/a-visit-to-the-doctor-students-a-b.doc 202.8 kB
  • Word 97-2003/a-visit-to-the-farm.doc 239.6 kB
  • Word 97-2003/a-wall-of-words.doc 50.7 kB
  • Word 97-2003/a-whole-new-world-list1.doc 159.2 kB
  • Word 97-2003/a_five_pound_note_1page.doc 38.4 kB
  • Word 97-2003/a_five_pound_note_1page_001.doc 38.4 kB
  • Word 97-2003/a_to_z_pictures_and_words.doc 159.7 kB
  • Word 97-2003/aansomeany.doc 29.7 kB
  • Word 97-2003/ab-dear-mr-president.doc 9.7 MB
  • Word 97-2003/abbreviations.doc 86.5 kB
  • Word 97-2003/abc-flashcards.doc 6.0 MB
  • Word 97-2003/abc-investigates-sarah-palin.doc 26.1 kB
  • Word 97-2003/abc-match-and-label.doc 861.2 kB
  • Word 97-2003/abc-practice.doc 261.1 kB
  • Word 97-2003/abc.doc 446.0 kB
  • Word 97-2003/about-myself.doc 4.3 MB
  • Word 97-2003/about-the-countries.doc 190.5 kB
  • Word 97-2003/about-wendy-filling-in-the-gaps.doc 109.1 kB
  • Word 97-2003/about-women-make-the-news-with-multiple-choice.doc 38.4 kB
  • Word 97-2003/ac.doc 35.3 kB
  • Word 97-2003/acceptance_speech_activity.doc 43.0 kB
  • Word 97-2003/accidentally-in-love.doc 33.8 kB
  • Word 97-2003/aches-pains-matching.doc 444.4 kB
  • Word 97-2003/aches-pains.doc 618.0 kB
  • Word 97-2003/achesnpains.doc 166.4 kB
  • Word 97-2003/act-1-a-simple-present-personal-info.doc 808.4 kB
  • Word 97-2003/act3.doc 545.3 kB
  • Word 97-2003/act3_001.doc 545.3 kB
  • Word 97-2003/action-crossword-u7.doc 598.5 kB
  • Word 97-2003/action-verbs-2.doc 255.0 kB
  • Word 97-2003/action-verbs-2011.doc 609.8 kB
  • Word 97-2003/action-verbs.doc 364.5 kB
  • Word 97-2003/action-verbs_001.doc 930.8 kB
  • Word 97-2003/action-verbs_002.doc 288.8 kB
  • Word 97-2003/action-verbs_003.doc 164.4 kB
  • Word 97-2003/actions-and-movements-1.doc 418.3 kB
  • Word 97-2003/actions-and-movements-2.doc 397.3 kB
  • Word 97-2003/actions-and-movements-matching1.doc 437.2 kB
  • Word 97-2003/actions-and-movements-matching2.doc 412.7 kB
  • Word 97-2003/actions-and-movements-matching3.doc 538.6 kB
  • Word 97-2003/actions-and-movements-matching4.doc 263.7 kB
  • Word 97-2003/actions-matching.doc 725.0 kB
  • Word 97-2003/actions.doc 105.0 kB
  • Word 97-2003/actitout.doc 31.2 kB
  • Word 97-2003/active-expressions.doc 181.2 kB
  • Word 97-2003/active-lifestyle.doc 503.8 kB
  • Word 97-2003/active-or-passive-14-02-2011.doc 36.9 kB
  • Word 97-2003/active-or-passive-present-continuous.doc 49.2 kB
  • Word 97-2003/active-or-passive-present-perfect.doc 54.3 kB
  • Word 97-2003/active-or-passive-present-simple.doc 77.3 kB
  • Word 97-2003/active-or-passive-three-texts.doc 62.0 kB
  • Word 97-2003/active-or-passive.doc 47.6 kB
  • Word 97-2003/active-passive-rephrasing.doc 109.6 kB
  • Word 97-2003/active-passive.doc 33.3 kB
  • Word 97-2003/active-to-passive-special-forms.doc 29.7 kB
  • Word 97-2003/active-to-passive.doc 27.1 kB
  • Word 97-2003/active-to-passive_001.doc 30.7 kB
  • Word 97-2003/activities-indirect-speech.doc 21.5 kB
  • Word 97-2003/activities_2nd_bachillerato_phrasals_passive.doc 30.7 kB
  • Word 97-2003/activity-1.doc 658.9 kB
  • Word 97-2003/activity-about-prep.doc 162.8 kB
  • Word 97-2003/activity-animals-and-parts-of-the-body.doc 126.5 kB
  • Word 97-2003/activity-evaluation-sheet.doc 41.5 kB
  • Word 97-2003/activity-jun-6-frequency.doc 1.1 MB
  • Word 97-2003/activity-sheet-7.doc 462.3 kB
  • Word 97-2003/activity-somewhere-over-the-rainbo1.doc 29.2 kB
  • Word 97-2003/activity-talking-about-my-vacation.doc 176.1 kB
  • Word 97-2003/activity.doc 272.9 kB
  • Word 97-2003/add-plus-more.doc 29.2 kB
  • Word 97-2003/adding-ion.doc 44.0 kB
  • Word 97-2003/addition_work_sheet.doc 3.7 MB
  • Word 97-2003/adele-dont-you-remember-by-adele-students2.doc 97.3 kB
  • Word 97-2003/adele-rolling-in-the-deep-350ark305-s246z252.doc 48.1 kB
  • Word 97-2003/adele-someone-like-you.doc 122.4 kB
  • Word 97-2003/adelle.doc 220.2 kB
  • Word 97-2003/adj-n-types.doc 25.6 kB
  • Word 97-2003/adj-syn.doc 289.8 kB
  • Word 97-2003/adj.doc 38.9 kB
  • Word 97-2003/adjective-exercises.doc 27.6 kB
  • Word 97-2003/adjective-formation-2012.doc 208.4 kB
  • Word 97-2003/adjective-or-adverb.doc 35.8 kB
  • Word 97-2003/adjective-preposition-quiz.doc 391.2 kB
  • Word 97-2003/adjective.doc 170.5 kB
  • Word 97-2003/adjectives-circle-and-colour.doc 336.4 kB
  • Word 97-2003/adjectives-ed-ng.doc 88.6 kB
  • Word 97-2003/adjectives-ed-or-ing.doc 408.1 kB
  • Word 97-2003/adjectives-ending-ed-ing-1.doc 37.9 kB
  • Word 97-2003/adjectives-kids.doc 379.4 kB
  • Word 97-2003/adjectives-of-feeling.doc 21.5 kB
  • Word 97-2003/adjectives-people.doc 79.4 kB
  • Word 97-2003/adjectives-phonetics.doc 6.3 MB
  • Word 97-2003/adjectives-speaking.doc 25.1 kB
  • Word 97-2003/adjectives-their-opposites-2.doc 94.2 kB
  • Word 97-2003/adjectives-their-opposites.doc 153.6 kB
  • Word 97-2003/adjectives-to-describe-food.doc 262.7 kB
  • Word 97-2003/adjectives-with-negatives-prefixes-n186-1.doc 206.8 kB
  • Word 97-2003/adjectives-with-negatives-prefixes-n186-2.doc 192.0 kB
  • Word 97-2003/adjectives.doc 103.9 kB
  • Word 97-2003/adjectives_001.doc 116.2 kB
  • Word 97-2003/adjectives_002.doc 185.3 kB
  • Word 97-2003/adjectives_003.doc 294.9 kB
  • Word 97-2003/adjectives_004.doc 84.0 kB
  • Word 97-2003/adjectives_005.doc 41.5 kB
  • Word 97-2003/adjectives_comparison.doc 38.9 kB
  • Word 97-2003/adjectives_comparison_001.doc 38.9 kB
  • Word 97-2003/adjectves.doc 154.6 kB
  • Word 97-2003/adjectves_comparartives.doc 155.1 kB
  • Word 97-2003/adjs-of-emotion.doc 28.2 kB
  • Word 97-2003/adjs-of-emotion_001.doc 28.2 kB
  • Word 97-2003/adoption.doc 23.6 kB
  • Word 97-2003/advanced-vocabulary-expressions-key.doc 62.5 kB
  • Word 97-2003/adventurous-dining.doc 916.5 kB
  • Word 97-2003/adverbs-and-adjectives.doc 63.5 kB
  • Word 97-2003/adverbs-of-frequency-1.doc 158.2 kB
  • Word 97-2003/adverbs-of-frequency-2012.doc 362.0 kB
  • Word 97-2003/adverbs-of-frequency-acabar.doc 509.4 kB
  • Word 97-2003/adverbs-of-frequency-set-2012.doc 202.8 kB
  • Word 97-2003/adverbs-of-frequency.doc 123.4 kB
  • Word 97-2003/adverbs-of-frequency_001.doc 121.3 kB
  • Word 97-2003/adverbs-of-frequency_002.doc 27.6 kB
  • Word 97-2003/adverbs-of-manner.doc 135.7 kB
  • Word 97-2003/adverbs-of-manner_001.doc 130.0 kB
  • Word 97-2003/adverbs-of-purpose.doc 25.1 kB
  • Word 97-2003/adverbs-of-timeplace-and-degree.doc 119.3 kB
  • Word 97-2003/adverbs-quantity.doc 32.3 kB
  • Word 97-2003/adverbs.doc 59.4 kB
  • Word 97-2003/adverbs_001.doc 86.5 kB
  • Word 97-2003/adverbs_002.doc 91.1 kB
  • Word 97-2003/adverbs_003.doc 94.7 kB
  • Word 97-2003/advertising-konwersacje.doc 3.4 MB
  • Word 97-2003/advertising-webquest.doc 84.0 kB
  • Word 97-2003/advice.doc 464.4 kB
  • Word 97-2003/advrerbs-easily-confused.doc 90.1 kB
  • Word 97-2003/affirmation-fce-word-formation.doc 200.7 kB
  • Word 97-2003/affirmation.doc 690.7 kB
  • Word 97-2003/after-sales-complaint-cloze-test.doc 47.1 kB
  • Word 97-2003/ahsubordinating-conjunction1.doc 17.4 kB
  • Word 97-2003/ailments-1.doc 179.7 kB
  • Word 97-2003/ailments-and-injuries.doc 146.4 kB
  • Word 97-2003/ailments-and-injuries_001.doc 530.4 kB
  • Word 97-2003/ain180t-got-not_-worksheet.doc 96.3 kB
  • Word 97-2003/alice-in-wonderland-book.doc 1.2 MB
  • Word 97-2003/all-about-me-for-boys.doc 279.0 kB
  • Word 97-2003/all-about-me-for-girls.doc 430.1 kB
  • Word 97-2003/all-about-my-partner-for-boys.doc 280.1 kB
  • Word 97-2003/all-about-my-partner-for-girls.doc 433.7 kB
  • Word 97-2003/all-conditionals-situations-2.doc 180.2 kB
  • Word 97-2003/all-i-want-for-christmas-is-you-by-mariah-carey.doc 461.3 kB
  • Word 97-2003/all-my-loving.doc 76.3 kB
  • Word 97-2003/alliterations.doc 42.0 kB
  • Word 97-2003/alp-grammartest1a.doc 33.3 kB
  • Word 97-2003/alp-grammartest2a.doc 33.8 kB
  • Word 97-2003/alphabet-wordsearchluso-made.doc 440.3 kB
  • Word 97-2003/alphabet.doc 49.2 kB
  • Word 97-2003/alphabet_001.doc 1.7 MB
  • Word 97-2003/alphabet_circus.doc 93.7 kB
  • Word 97-2003/alphabet_letters_rev_wa1.doc 23.6 kB
  • Word 97-2003/alphabet_letters_rev_wa1_001.doc 23.6 kB
  • Word 97-2003/already-just-yet-before-worksheet.doc 37.4 kB
  • Word 97-2003/always.doc 26.1 kB
  • Word 97-2003/american-british.doc 44.0 kB
  • Word 97-2003/american-currency.doc 246.3 kB
  • Word 97-2003/american-fast-food-class.doc 51.7 kB
  • Word 97-2003/american-presidents.doc 78.8 kB
  • Word 97-2003/american-shine-3-unit-3.doc 45.6 kB
  • Word 97-2003/american-slang.doc 36.4 kB
  • Word 97-2003/American_Currency.doc 246.3 kB
  • Word 97-2003/amsterdam.doc 2.7 MB
  • Word 97-2003/amy-johnson-esl.doc 112.1 kB
  • Word 97-2003/an-englishman-in-new-york.doc 41.0 kB
  • Word 97-2003/an-excllent-test.doc 479.2 kB
  • Word 97-2003/an_activity_to_reinforce_vocabulry1.doc 36.4 kB
  • Word 97-2003/and-the-winner-is.doc 6.7 MB
  • Word 97-2003/angels-among-us.doc 55.8 kB
  • Word 97-2003/angels-robin-willians-2.doc 49.2 kB
  • Word 97-2003/angelsworksheet.doc 82.4 kB
  • Word 97-2003/angol-kis-233retts233gi-sz243beli-t233mak246r246k.doc 69.1 kB
  • Word 97-2003/angry-and-the-beanstalk.doc 1.1 MB
  • Word 97-2003/animal-children.doc 48.6 kB
  • Word 97-2003/animal-riddles-1-easy.doc 226.3 kB
  • Word 97-2003/animal-riddles.doc 397.8 kB
  • Word 97-2003/animal-world.doc 357.4 kB
  • Word 97-2003/animal_lotto_boards_1-6.doc 2.9 MB
  • Word 97-2003/animal_riddles.doc 397.8 kB
  • Word 97-2003/animal_riddles_001.doc 397.8 kB
  • Word 97-2003/animals-_-flashcards.doc 291.0 kB
  • Word 97-2003/animals-cards.doc 841.7 kB
  • Word 97-2003/animals-comparatives-ws.doc 221.7 kB
  • Word 97-2003/animals-cut-and-paste.doc 335.9 kB
  • Word 97-2003/animals-exc.doc 4.6 MB
  • Word 97-2003/animals-game.doc 222.7 kB
  • Word 97-2003/animals-guess.doc 299.0 kB
  • Word 97-2003/animals-matching-2012.doc 279.6 kB
  • Word 97-2003/animals-modal-verbs.doc 178.7 kB
  • Word 97-2003/animals-of-the-farm-activities.doc 625.2 kB
  • Word 97-2003/animals-plural-and-singular-forms.doc 183.8 kB
  • Word 97-2003/animals-word-search.doc 555.0 kB
  • Word 97-2003/animals.doc 180.2 kB
  • Word 97-2003/animals1.doc 178.7 kB
  • Word 97-2003/animals2.doc 180.7 kB
  • Word 97-2003/animals_001.doc 69.6 kB
  • Word 97-2003/animals_002.doc 496.1 kB
  • Word 97-2003/animals_003.doc 202.8 kB
  • Word 97-2003/animals_004.doc 1.1 MB
  • Word 97-2003/animals_005.doc 360.4 kB
  • Word 97-2003/animals_lesson_plan.doc 1.0 MB
  • Word 97-2003/animlas-guess.doc 41.0 kB
  • Word 97-2003/annoying_cards.doc 277.5 kB
  • Word 97-2003/another-day-in-paradise.doc 26.6 kB
  • Word 97-2003/ans.doc 37.9 kB
  • Word 97-2003/antonymssynonyms.doc 50.7 kB
  • Word 97-2003/appearance.doc 94.2 kB
  • Word 97-2003/appearance_001.doc 273.9 kB
  • Word 97-2003/appearence-tablica-lkz-internet.doc 64.5 kB
  • Word 97-2003/apple-tree-letter-bingo.doc 1.1 MB
  • Word 97-2003/appliances_worksheet_full.doc 151.0 kB
  • Word 97-2003/application-form-elementary.doc 48.1 kB
  • Word 97-2003/applying-for-a-job.doc 39.9 kB
  • Word 97-2003/appositive-worksheet.doc 28.7 kB
  • Word 97-2003/apt-building.doc 226.8 kB
  • Word 97-2003/arakin-3.doc 39.9 kB
  • Word 97-2003/are-you-addicted-boardgame.doc 208.4 kB
  • Word 97-2003/are-you-an-environmentalist.doc 38.9 kB
  • Word 97-2003/are-you-busy.doc 359.9 kB
  • Word 97-2003/are-you-for-or-against-tv.doc 124.9 kB
  • Word 97-2003/are-you-gonna-go-my-way.doc 12.8 kB
  • Word 97-2003/are_you_a_computer_expert.doc 350.2 kB
  • Word 97-2003/are_you_a_computer_expert_001.doc 350.2 kB
  • Word 97-2003/argument-organizer.doc 30.7 kB
  • Word 97-2003/aries.doc 36.4 kB
  • Word 97-2003/armstrong-comprehension-orale.doc 217.1 kB
  • Word 97-2003/around-my-town.doc 518.7 kB
  • Word 97-2003/around-the-house.doc 506.4 kB
  • Word 97-2003/around-the-rugged-rocks.doc 22.5 kB
  • Word 97-2003/arthur-the-rat-1.doc 37.9 kB
  • Word 97-2003/articles-2.doc 89.6 kB
  • Word 97-2003/articles-buses-and-trains.doc 76.3 kB
  • Word 97-2003/articles-overview.doc 74.2 kB
  • Word 97-2003/articles-test.doc 63.5 kB
  • Word 97-2003/articles.doc 27.1 kB
  • Word 97-2003/articles_001.doc 81.9 kB
  • Word 97-2003/articles_002.doc 273.4 kB
  • Word 97-2003/articles_003.doc 278.5 kB
  • Word 97-2003/articles_004.doc 28.2 kB
  • Word 97-2003/articles_005.doc 124.4 kB
  • Word 97-2003/articles_006.doc 210.4 kB
  • Word 97-2003/articlestest.doc 28.2 kB
  • Word 97-2003/articlestest_001.doc 28.2 kB
  • Word 97-2003/as-like.doc 168.4 kB
  • Word 97-2003/as-review-topics.doc 53.8 kB
  • Word 97-2003/as-review-topics_1_.doc 53.8 kB
  • Word 97-2003/as-vs-like.doc 149.5 kB
  • Word 97-2003/ascella-modals-handout.doc 37.4 kB
  • Word 97-2003/ask-and-answer-name-and-age.doc 107.5 kB
  • Word 97-2003/ask-questions-in-the-future-simple.doc 51.2 kB
  • Word 97-2003/askanswer.doc 25.1 kB
  • Word 97-2003/asking-about-the-way.doc 300.5 kB
  • Word 97-2003/asking-for-giving-directions.doc 108.0 kB
  • Word 97-2003/asking-info.doc 36.4 kB
  • Word 97-2003/assessment-formmodified.doc 289.8 kB
  • Word 97-2003/astrology-and-the-zodiac.doc 1.3 MB
  • Word 97-2003/astrology.doc 23.0 kB
  • Word 97-2003/at-an-airport.doc 28.7 kB
  • Word 97-2003/at-school-multiple-choice.doc 319.0 kB
  • Word 97-2003/at-school.doc 293.9 kB
  • Word 97-2003/at-school_001.doc 293.9 kB
  • Word 97-2003/at-school_1_.doc 297.0 kB
  • Word 97-2003/at-shool-verbs1.doc 227.8 kB
  • Word 97-2003/at-the-airport.doc 341.0 kB
  • Word 97-2003/at-the-beach.doc 300.0 kB
  • Word 97-2003/at-the-beach_001.doc 268.3 kB
  • Word 97-2003/at-the-post-office.doc 349.7 kB
  • Word 97-2003/at-the-restaurant.doc 159.7 kB
  • Word 97-2003/at-the-restaurant_001.doc 162.8 kB
  • Word 97-2003/at-the-restaurant_ws.doc 102.4 kB
  • Word 97-2003/at-the-supermarket.doc 17.4 kB
  • Word 97-2003/at.doc 31.7 kB
  • Word 97-2003/at_restaurant_game.doc 174.1 kB
  • Word 97-2003/atividade-big-brother.doc 270.3 kB
  • Word 97-2003/auction-bids.doc 36.9 kB
  • Word 97-2003/australia-angl.doc 294.9 kB
  • Word 97-2003/australia-facts.doc 200.2 kB
  • Word 97-2003/australia_dream_job.doc 2.8 MB
  • Word 97-2003/autobiographical-mingle.doc 54.3 kB
  • Word 97-2003/autodictation.doc 44.5 kB
  • Word 97-2003/autumn-pictionary.doc 302.6 kB
  • Word 97-2003/autumn.doc 23.0 kB
  • Word 97-2003/autumn_001.doc 212.0 kB
  • Word 97-2003/autumne-matching.doc 213.0 kB
  • Word 97-2003/auxiliary-verbs-gap-filling.doc 473.6 kB
  • Word 97-2003/avril-lavigne-reading-comprehension.doc 47.6 kB
  • Word 97-2003/avril-lavigne-sk8er-boy.doc 44.0 kB
  • Word 97-2003/b1-relative-pronouns-who-which-where.doc 34.8 kB
  • Word 97-2003/b2_getting-ready-for-pc1.doc 230.4 kB
  • Word 97-2003/b2_gettingreadyforpc2.doc 101.4 kB
  • Word 97-2003/b2ub6howdoyouget.doc 161.3 kB
  • Word 97-2003/baby-its-cold-outside_handout.doc 180.2 kB
  • Word 97-2003/back-home.doc 65.5 kB
  • Word 97-2003/back-home2.doc 65.5 kB
  • Word 97-2003/back-home_001.doc 65.5 kB
  • Word 97-2003/back-to-school.doc 879.1 kB
  • Word 97-2003/back.doc 286.2 kB
  • Word 97-2003/bad-day-worksheet.doc 232.4 kB
  • Word 97-2003/bang-20-nghe.doc 905.7 kB
  • Word 97-2003/barking-at-the-moon-listen-to-the-song-and-doc.doc 112.6 kB
  • Word 97-2003/barry-manilow-song-worksheet.doc 63.0 kB
  • Word 97-2003/base-and-strong-adjectives-game.doc 27.1 kB
  • Word 97-2003/basic-cards.doc 54.3 kB
  • Word 97-2003/basic-review.doc 45.1 kB
  • Word 97-2003/basic-skills-beckham-compr.doc 92.7 kB
  • Word 97-2003/basic_t.doc 47.1 kB
  • Word 97-2003/bathroom.doc 209.4 kB
  • Word 97-2003/battle-ship.doc 30.7 kB
  • Word 97-2003/battle.doc 21.0 kB
  • Word 97-2003/battleship_possessive_angelinajolie.doc 75.3 kB
  • Word 97-2003/be-a-perfect-poet.doc 94.7 kB
  • Word 97-2003/be-vocabulary-for-tests-final.doc 47.6 kB
  • Word 97-2003/beach-boys-activity.doc 27.1 kB
  • Word 97-2003/beast-of-burden.doc 31.2 kB
  • Word 97-2003/beatles-esl.doc 330.8 kB
  • Word 97-2003/beatles-ns-el-8.doc 11.3 kB
  • Word 97-2003/beautiful-mess-handout.doc 25.6 kB
  • Word 97-2003/beautiful.doc 22.0 kB
  • Word 97-2003/beauty-and-the-beast-by-grimm.doc 171.0 kB
  • Word 97-2003/beauty-salon.doc 143.4 kB
  • Word 97-2003/beauty-salon_001.doc 143.9 kB
  • Word 97-2003/beautyandthebeat_sequencing.doc 29.7 kB
  • Word 97-2003/beautyandthebeat_sequencing_001.doc 29.7 kB
  • Word 97-2003/because-you-liked.doc 22.0 kB
  • Word 97-2003/because-you-loved-me-printable.doc 37.9 kB
  • Word 97-2003/because-you-loved-me.doc 461.8 kB
  • Word 97-2003/bedroom-there-is-are.doc 270.8 kB
  • Word 97-2003/bedroom.doc 224.3 kB
  • Word 97-2003/bedroom_001.doc 266.2 kB
  • Word 97-2003/bedroom_002.doc 187.4 kB
  • Word 97-2003/bee-movie.doc 341.5 kB
  • Word 97-2003/been-vs-gone.doc 538.1 kB
  • Word 97-2003/beerbiking.doc 25.6 kB
  • Word 97-2003/before-after-and-at-school.doc 239.1 kB
  • Word 97-2003/beginner-revision-test.doc 180.7 kB
  • Word 97-2003/behaviour_pictures.doc 65.0 kB
  • Word 97-2003/behind-blue-eyes.doc 85.0 kB
  • Word 97-2003/beijing-olympics-comparatives-and-superlatives.doc 221.2 kB
  • Word 97-2003/being-happier.doc 30.7 kB
  • Word 97-2003/being-similar-two-of-a-kind.doc 79.9 kB
  • Word 97-2003/bel5.doc 119.3 kB
  • Word 97-2003/bel6.doc 2.3 MB
  • Word 97-2003/bel6_001.doc 2.3 MB
  • Word 97-2003/bela-and-the-elephant.doc 331.8 kB
  • Word 97-2003/bellringer.doc 71.2 kB
  • Word 97-2003/benjamin-zephaniah-serious-luv.doc 64.0 kB
  • Word 97-2003/best-friends.doc 105.0 kB
  • Word 97-2003/best-thing-i-never-had-beyonce.doc 304.1 kB
  • Word 97-2003/bet.doc 56.8 kB
  • Word 97-2003/bet_001.doc 56.8 kB
  • Word 97-2003/bettys-house.doc 287.2 kB
  • Word 97-2003/beyonce-if-a-were-a-boy.doc 27.6 kB
  • Word 97-2003/beyonce-irreplaceable.doc 62.0 kB
  • Word 97-2003/beyonce-irreplaceable_001.doc 69.6 kB
  • Word 97-2003/beyonce.doc 39.4 kB
  • Word 97-2003/big-brother.doc 246.8 kB
  • Word 97-2003/big-time-rush.doc 43.5 kB
  • Word 97-2003/bingo-2.doc 1.6 MB
  • Word 97-2003/bingo-animals.doc 2.1 MB
  • Word 97-2003/bingo-antonyms.doc 40.4 kB
  • Word 97-2003/bingo-antonyms_001.doc 21.5 kB
  • Word 97-2003/bingo-for-number-pronunciation.doc 35.8 kB
  • Word 97-2003/bingo-sport.doc 31.7 kB
  • Word 97-2003/bio-data.doc 39.9 kB
  • Word 97-2003/birds.doc 268.8 kB
  • Word 97-2003/birthday-party.doc 193.5 kB
  • Word 97-2003/birthday_boats.doc 220.7 kB
  • Word 97-2003/black-eyed-peas-lyrics.doc 53.2 kB
  • Word 97-2003/blink-182-song-worksheet.doc 1.4 MB
  • Word 97-2003/bmcc-networking-game.doc 37.9 kB
  • Word 97-2003/board-game-how-do-you-feel.doc 140.3 kB
  • Word 97-2003/board-game-on-manners.doc 82.4 kB
  • Word 97-2003/board-game-situs-pre-int.doc 2.7 MB
  • Word 97-2003/board-game_irregular-verbs.doc 39.9 kB
  • Word 97-2003/boardgame-verb-tenses.doc 168.4 kB
  • Word 97-2003/boardgame.doc 1.5 MB
  • Word 97-2003/bob-marley-song.doc 47.1 kB
  • Word 97-2003/body-and-face-for-kids.doc 9.5 MB
  • Word 97-2003/body-language-ok.doc 247.3 kB
  • Word 97-2003/body-organs.doc 3.8 MB
  • Word 97-2003/body-parts-homer.doc 295.9 kB
  • Word 97-2003/body-parts-kids.doc 274.4 kB
  • Word 97-2003/body-verbs.doc 276.5 kB
  • Word 97-2003/body-worksheet.doc 184.3 kB
  • Word 97-2003/body.doc 182.3 kB
  • Word 97-2003/body_001.doc 280.1 kB
  • Word 97-2003/body_002.doc 161.8 kB
  • Word 97-2003/body_003.doc 174.6 kB
  • Word 97-2003/bon-jovi.doc 31.2 kB
  • Word 97-2003/bony-fingers-bony-toes.doc 149.0 kB
  • Word 97-2003/book-week-ivstd-to-up-load.doc 66.0 kB
  • Word 97-2003/booklet-2010.doc 1.5 MB
  • Word 97-2003/booklet-2010_001.doc 1.6 MB
  • Word 97-2003/bookmarks-fact-file.doc 3.5 MB
  • Word 97-2003/books-and-reading.doc 343.6 kB
  • Word 97-2003/bored-or-boring.doc 214.5 kB
  • Word 97-2003/borrow-and-lend.doc 86.0 kB
  • Word 97-2003/borrow_lend.doc 28.7 kB
  • Word 97-2003/borrow_lend_001.doc 28.7 kB
  • Word 97-2003/boulevard-of-broken-dreams-worksheet.doc 83.5 kB
  • Word 97-2003/boulevard-of-broken-dreams-worksheet_001.doc 79.4 kB
  • Word 97-2003/boy-girl-to-draw.doc 29.2 kB
  • Word 97-2003/boys-dont-cry.doc 34.3 kB
  • Word 97-2003/brambly-hedge_spring-story.doc 37.9 kB
  • Word 97-2003/brave-movie-worksheet.doc 3.9 MB
  • Word 97-2003/breakfast-at-tiffanys-song.doc 63.5 kB
  • Word 97-2003/bridesmaids-movie-handout.doc 1.0 MB
  • Word 97-2003/british-and-american-education.doc 102.9 kB
  • Word 97-2003/british-empire.doc 99.3 kB
  • Word 97-2003/british-english-vs-american-english.doc 254.0 kB
  • Word 97-2003/british-english.doc 82.4 kB
  • Word 97-2003/british-english_001.doc 196.6 kB
  • Word 97-2003/british-money.doc 280.6 kB
  • Word 97-2003/british-versus-american-english.doc 90.1 kB
  • Word 97-2003/britney-spears-criminal.doc 282.1 kB
  • Word 97-2003/britney-spears-hold-it-against-me.doc 144.9 kB
  • Word 97-2003/brittish-and-american-english.doc 151.6 kB
  • Word 97-2003/building-and-places.doc 1.0 MB
  • Word 97-2003/building-trades.doc 677.9 kB
  • Word 97-2003/buildings.doc 407.6 kB
  • Word 97-2003/business-protocol-cultural-discussion.doc 25.6 kB
  • Word 97-2003/busy-teacher.doc 55.8 kB
  • Word 97-2003/busy-teachers-the-lion-king.doc 503.3 kB
  • Word 97-2003/busy-teachers.doc 507.4 kB
  • Word 97-2003/busy.doc 639.5 kB
  • Word 97-2003/busy_001.doc 633.3 kB
  • Word 97-2003/buying-a-home.doc 56.8 kB
  • Word 97-2003/c.doc 70.1 kB
  • Word 97-2003/californication.doc 31.2 kB
  • Word 97-2003/calling-all-the-monsters-china-mclain.doc 140.3 kB
  • Word 97-2003/calling-list.doc 26.1 kB
  • Word 97-2003/calvins-daily-routine.doc 369.2 kB
  • Word 97-2003/camping-with-my-friends.doc 284.2 kB
  • Word 97-2003/camping.doc 180.2 kB
  • Word 97-2003/can-2.doc 154.6 kB
  • Word 97-2003/can-ability.doc 477.2 kB
  • Word 97-2003/can-and-imperatives.doc 468.0 kB
  • Word 97-2003/can-cant.doc 122.9 kB
  • Word 97-2003/can-cant_001.doc 220.2 kB
  • Word 97-2003/can-cant_002.doc 33.3 kB
  • Word 97-2003/can-stupidity-kill-you.doc 1.5 MB
  • Word 97-2003/can-you-find-things-in-the-picture.doc 86.5 kB
  • Word 97-2003/can-you.doc 460.3 kB
  • Word 97-2003/can-you_001.doc 128.0 kB
  • Word 97-2003/can-you_002.doc 35.8 kB
  • Word 97-2003/candys-life.doc 256.0 kB
  • Word 97-2003/car-accidents-worksheet.doc 31.2 kB
  • Word 97-2003/car-accidents-worksheet_001.doc 31.2 kB
  • Word 97-2003/caratula-sfiii-2010-pre-first-all-about-me.doc 31.2 kB
  • Word 97-2003/cardinal-numbers.doc 223.2 kB
  • Word 97-2003/cardinal-numbers_001.doc 182.3 kB
  • Word 97-2003/cardinal-numbers_002.doc 92.7 kB
  • Word 97-2003/cards-gerund-or-inf.doc 35.3 kB
  • Word 97-2003/cards-to-introduce-yourself-game.doc 42.5 kB
  • Word 97-2003/carly-rae-jepsen-call-me-maybe-past-simple-and.doc 37.4 kB
  • Word 97-2003/carly-rae-jepsen-call-me-maybe-song-activity.doc 36.9 kB
  • Word 97-2003/carnivaltext.doc 33.3 kB
  • Word 97-2003/caro-emerald_a-night-like-this.doc 387.6 kB
  • Word 97-2003/casper-test.doc 54.8 kB
  • Word 97-2003/categories-and-classification.doc 83.5 kB
  • Word 97-2003/catogorize.doc 216.6 kB
  • Word 97-2003/causative-board-game.doc 37.4 kB
  • Word 97-2003/ce-upper-wordformation.doc 25.1 kB
  • Word 97-2003/cecilia.doc 33.3 kB
  • Word 97-2003/celebration-planner.doc 481.3 kB
  • Word 97-2003/celine-dion.doc 165.9 kB
  • Word 97-2003/certificate_best_mother.doc 62.0 kB
  • Word 97-2003/cex2c04wonderfultonight.doc 54.8 kB
  • Word 97-2003/ch2.doc 100.9 kB
  • Word 97-2003/change-the-following-formal-informal.doc 24.6 kB
  • Word 97-2003/changing.doc 23.0 kB
  • Word 97-2003/chapter-11-audio-bath-student.doc 16.4 kB
  • Word 97-2003/character-poster.doc 20.0 kB
  • Word 97-2003/character.doc 250.4 kB
  • Word 97-2003/charlie-and-the-chocolate-factory.doc 533.0 kB
  • Word 97-2003/charlie-the-chocolate-factory.doc 4.0 MB
  • Word 97-2003/charliebrown_thanksgiving.doc 482.3 kB
  • Word 97-2003/charlottes-web.doc 297.0 kB
  • Word 97-2003/chartirrvrb.doc 35.8 kB
  • Word 97-2003/chasing-cars.doc 23.0 kB
  • Word 97-2003/check-and-control-with-expressions.doc 1.1 MB
  • Word 97-2003/children-for-whom-school-means-nothing.doc 219.6 kB
  • Word 97-2003/childrenandpoverty.doc 64.0 kB
  • Word 97-2003/childrens-problems.doc 52.7 kB
  • Word 97-2003/chinese-zodiac-great-race-worksheets.doc 71.2 kB
  • Word 97-2003/choose-the-right-preposition.doc 26.1 kB
  • Word 97-2003/chores-and-errands.doc 610.3 kB
  • Word 97-2003/chores.doc 40.4 kB
  • Word 97-2003/christmas-candles.doc 408.1 kB
  • Word 97-2003/christmas-cards-wishes-to-cut-out.doc 75.3 kB
  • Word 97-2003/christmas-carol-booklet.doc 36.4 kB
  • Word 97-2003/christmas-crossword.doc 408.6 kB
  • Word 97-2003/christmas-ii.doc 619.0 kB
  • Word 97-2003/christmas-matching.doc 197.1 kB
  • Word 97-2003/christmas-quiz-key.doc 385.5 kB
  • Word 97-2003/christmas-quiz.doc 165.9 kB
  • Word 97-2003/christmas-time-elementary.doc 173.6 kB
  • Word 97-2003/christmas-video.doc 2.6 MB
  • Word 97-2003/christmas-voc.doc 633.9 kB
  • Word 97-2003/christmas-vocabulary-elementary.doc 2.0 MB
  • Word 97-2003/christmas-vocabulary-for-esl-printables.doc 297.0 kB
  • Word 97-2003/christmas-vocabulary.doc 216.6 kB
  • Word 97-2003/christmas-vocabulary_001.doc 1.1 MB
  • Word 97-2003/christmas-wall-poster.doc 459.3 kB
  • Word 97-2003/christmas-wordsearch-2011.doc 243.2 kB
  • Word 97-2003/christmas-worksheet-luso-made-december-19-2011.doc 370.2 kB
  • Word 97-2003/christmas.doc 284.2 kB
  • Word 97-2003/christmas_001.doc 1.1 MB
  • Word 97-2003/christmas_crossword.doc 90.6 kB
  • Word 97-2003/christmas_crossword_001.doc 90.6 kB
  • Word 97-2003/christmaskey.doc 497.2 kB
  • Word 97-2003/christy-moore-tx-224-trous.doc 31.2 kB
  • Word 97-2003/cinderella-3-kopiyi.doc 46.1 kB
  • Word 97-2003/cinderella.doc 139.8 kB
  • Word 97-2003/cinderella_maze.doc 37.9 kB
  • Word 97-2003/cinema-and-films.doc 92.7 kB
  • Word 97-2003/cinema.doc 20.5 kB
  • Word 97-2003/city-activity.doc 33.3 kB
  • Word 97-2003/city-of-blinding-lights.doc 53.8 kB
  • Word 97-2003/clase-2-like-olympic-games.doc 439.8 kB
  • Word 97-2003/class-1-std.doc 220.7 kB
  • Word 97-2003/class-language-1.doc 660.5 kB
  • Word 97-2003/class-rules.doc 27.6 kB
  • Word 97-2003/classhunt.doc 25.1 kB
  • Word 97-2003/classroom-language-for-students.doc 96.8 kB
  • Word 97-2003/classroom-language-matchng.doc 154.6 kB
  • Word 97-2003/classroom-language-matchng_001.doc 159.2 kB
  • Word 97-2003/classroom-language.doc 172.0 kB
  • Word 97-2003/classroom-language2.doc 46.1 kB
  • Word 97-2003/classroom-language_001.doc 134.7 kB
  • Word 97-2003/classroom-objects-class-mingle.doc 282.1 kB
  • Word 97-2003/classroom-objects.doc 75.3 kB
  • Word 97-2003/classroom-pictionary.doc 619.5 kB
  • Word 97-2003/classroom-verbs.doc 224.3 kB
  • Word 97-2003/clauses-of-contrast.doc 38.9 kB
  • Word 97-2003/cleaning_lady.doc 25.6 kB
  • Word 97-2003/cleaning_lady_001.doc 25.6 kB
  • Word 97-2003/click.doc 287.2 kB
  • Word 97-2003/climate-change.doc 56.8 kB
  • Word 97-2003/clock.doc 218.6 kB
  • Word 97-2003/closer-to-the-edge-30secs-2-mars-acoustic.doc 276.5 kB
  • Word 97-2003/Closer_to_The_Edge_30sec_s_2_Mars_acoustic_.doc 276.5 kB
  • Word 97-2003/Closer_to_The_Edge_30sec_s_2_Mars_acoustic__001.doc 277.0 kB
  • Word 97-2003/clothe-multiple-2012.doc 786.4 kB
  • Word 97-2003/clothes-1.doc 392.2 kB
  • Word 97-2003/clothes-crossword-2011.doc 321.5 kB
  • Word 97-2003/clothes-iii.doc 322.6 kB
  • Word 97-2003/clothes-missing.doc 227.3 kB
  • Word 97-2003/clothes-o111llie.doc 5.9 MB
  • Word 97-2003/clothes-poster-2012.doc 506.9 kB
  • Word 97-2003/clothes-wordsearch.doc 356.9 kB
  • Word 97-2003/clothes.doc 127.0 kB
  • Word 97-2003/clothes_001.doc 1.4 MB
  • Word 97-2003/clothes_002.doc 262.7 kB
  • Word 97-2003/clothes_003.doc 228.4 kB
  • Word 97-2003/clothes_004.doc 576.5 kB
  • Word 97-2003/clothes_005.doc 1.2 MB
  • Word 97-2003/clothes_006.doc 493.6 kB
  • Word 97-2003/clothes_4186-primaria-updated.doc 706.0 kB
  • Word 97-2003/clothing-games-and-activities.doc 28.7 kB
  • Word 97-2003/clothing-memory-game.doc 226.8 kB
  • Word 97-2003/clothing-worksheet-1.doc 63.5 kB
  • Word 97-2003/cloze-test-all-about-reading.doc 71.7 kB
  • Word 97-2003/colbie_caillat.doc 35.8 kB
  • Word 97-2003/colbie_caillat_001.doc 35.8 kB
  • Word 97-2003/coldplay-viva-la-vida-lyrics.doc 32.8 kB
  • Word 97-2003/colegio-cristiano-1a.doc 4.6 MB
  • Word 97-2003/collect_words.doc 40.4 kB
  • Word 97-2003/collective-nouns-flashcards.doc 2.1 MB
  • Word 97-2003/collective-nouns-ii.doc 186.9 kB
  • Word 97-2003/collective-nouns.doc 268.8 kB
  • Word 97-2003/collective-nouns_001.doc 216.6 kB
  • Word 97-2003/collocation-with-common-verbs.doc 27.6 kB
  • Word 97-2003/colloquial-and-informal-expressions.doc 133.6 kB
  • Word 97-2003/color.doc 37.9 kB
  • Word 97-2003/color_001.doc 38.4 kB
  • Word 97-2003/colors-wordsearch.doc 46.1 kB
  • Word 97-2003/colour-the-animals.doc 41.5 kB
  • Word 97-2003/colour-these-balloons.doc 46.1 kB
  • Word 97-2003/colour-word-search.doc 118.3 kB
  • Word 97-2003/colours-and-numbers.doc 178.2 kB
  • Word 97-2003/colours-match.doc 110.1 kB
  • Word 97-2003/colours-matching.doc 75.3 kB
  • Word 97-2003/colours-t.doc 172.5 kB
  • Word 97-2003/colours.doc 34.8 kB
  • Word 97-2003/colours_001.doc 108.0 kB
  • Word 97-2003/colours_002.doc 326.1 kB
  • Word 97-2003/colours_003.doc 95.2 kB
  • Word 97-2003/colours_004.doc 58.4 kB
  • Word 97-2003/colours_005.doc 770.6 kB
  • Word 97-2003/colours_006.doc 33.3 kB
  • Word 97-2003/come-home-perry_contractions.doc 138.2 kB
  • Word 97-2003/comics.doc 115.2 kB
  • Word 97-2003/common-stative-passive-verbs.doc 26.1 kB
  • Word 97-2003/common-words.doc 535.0 kB
  • Word 97-2003/commonly-confused-words.doc 76.3 kB
  • Word 97-2003/comp-and-sup.doc 70.7 kB
  • Word 97-2003/comp-super-worksheet.doc 33.8 kB
  • Word 97-2003/comp-superl-stars4.doc 53.8 kB
  • Word 97-2003/comparative-adjectives.doc 40.4 kB
  • Word 97-2003/comparative-adjectives_001.doc 97.3 kB
  • Word 97-2003/comparative.doc 35.8 kB
  • Word 97-2003/comparative_superlative-degree.doc 353.8 kB
  • Word 97-2003/comparatives-and-superlatives.doc 534.0 kB
  • Word 97-2003/comparatives-and-superlatives_001.doc 41.5 kB
  • Word 97-2003/comparatives-and-superlatives_002.doc 37.4 kB
  • Word 97-2003/comparatives-superlatives.doc 38.4 kB
  • Word 97-2003/comparatives.doc 283.6 kB
  • Word 97-2003/compare-mouse-elephant.doc 124.9 kB
  • Word 97-2003/comparing-people.doc 88.1 kB
  • Word 97-2003/comparison-game.doc 285.2 kB
  • Word 97-2003/comparison-of-adjectives.doc 28.7 kB
  • Word 97-2003/comparison-of-adjectives_001.doc 51.7 kB
  • Word 97-2003/comparison-short-adjectives.doc 40.4 kB
  • Word 97-2003/comparisons-english.doc 31.7 kB
  • Word 97-2003/complain-in-a-restaurant.doc 40.4 kB
  • Word 97-2003/complaint-after-sales.doc 56.3 kB
  • Word 97-2003/complaint.doc 67.6 kB
  • Word 97-2003/complete-the-cv-using-the-info.doc 72.2 kB
  • Word 97-2003/complete-the-dots-and-then-color.doc 52.2 kB
  • Word 97-2003/complete-the-dots-and-then-color2.doc 314.4 kB
  • Word 97-2003/complete-the-following-chart-1.doc 56.3 kB
  • Word 97-2003/complete-the-sentences-with-the-correct.doc 27.6 kB
  • Word 97-2003/complete-the-song.doc 1.2 MB
  • Word 97-2003/complex-object-_exercises.doc 110.1 kB
  • Word 97-2003/complex-object-with-to.doc 298.0 kB
  • Word 97-2003/complex-object-without-to.doc 79.9 kB
  • Word 97-2003/compound-complex-sentence.doc 26.1 kB
  • Word 97-2003/compound-nouns.doc 251.9 kB
  • Word 97-2003/compound-nouns_001.doc 242.2 kB
  • Word 97-2003/compound-nouns_002.doc 48.6 kB
  • Word 97-2003/compound-words-1.doc 469.0 kB
  • Word 97-2003/compound-words-closed-forms.doc 493.1 kB
  • Word 97-2003/comprehension-exercise.doc 38.9 kB
  • Word 97-2003/comprehension_question-types.doc 42.0 kB
  • Word 97-2003/comprehensive-test-8eme-mars-8-2012-for-esl-prin.doc 393.2 kB
  • Word 97-2003/computer-lab-rules.doc 126.0 kB
  • Word 97-2003/computer.doc 700.9 kB
  • Word 97-2003/computers-matching.doc 406.0 kB
  • Word 97-2003/computers.doc 229.9 kB
  • Word 97-2003/conditional-clauses.doc 74.8 kB
  • Word 97-2003/conditional-sentence1.doc 236.5 kB
  • Word 97-2003/conditional-sentences-3.doc 54.8 kB
  • Word 97-2003/conditional-sentences.doc 41.0 kB
  • Word 97-2003/conditional-sentences_-ana_dec.doc 149.0 kB
  • Word 97-2003/conditional.doc 2.8 MB
  • Word 97-2003/conditional_001.doc 31.7 kB
  • Word 97-2003/conditional_sentences_type_i_and_ii.doc 38.9 kB
  • Word 97-2003/conditional_sentences_type_i_and_ii_001.doc 38.9 kB
  • Word 97-2003/conditionals-2.doc 46.6 kB
  • Word 97-2003/conditionals-contrast.doc 150.5 kB
  • Word 97-2003/conditionals-review.doc 72.7 kB
  • Word 97-2003/conditionals-review_1_.doc 71.7 kB
  • Word 97-2003/conditionals-summary.doc 96.3 kB
  • Word 97-2003/conditionals.doc 32.8 kB
  • Word 97-2003/conditionals1.doc 39.4 kB
  • Word 97-2003/conditionals_001.doc 32.8 kB
  • Word 97-2003/conditionals_002.doc 144.4 kB
  • Word 97-2003/conditionals_003.doc 23.0 kB
  • Word 97-2003/conditionals_004.doc 38.4 kB
  • Word 97-2003/conditionalstypes1-2-cartoon.doc 64.5 kB
  • Word 97-2003/confusing-words.doc 26.1 kB
  • Word 97-2003/conjunction-because.doc 28.2 kB
  • Word 97-2003/conjunctions-overview.doc 50.2 kB
  • Word 97-2003/connectors.doc 110.6 kB
  • Word 97-2003/connectors_001.doc 38.4 kB
  • Word 97-2003/cono.doc 42.0 kB
  • Word 97-2003/consider-me-gone-by-sting.doc 163.3 kB
  • Word 97-2003/consonant-blends-board-game.doc 485.4 kB
  • Word 97-2003/consonant-blends-mine.doc 2.2 MB
  • Word 97-2003/consonants.doc 50.2 kB
  • Word 97-2003/containers-ws.doc 149.5 kB
  • Word 97-2003/containers.doc 178.7 kB
  • Word 97-2003/continuous-past-tense-fact-sheet.doc 53.2 kB
  • Word 97-2003/controversial-statements-tv.doc 38.9 kB
  • Word 97-2003/conversation-a-mirror-before-your-very-eyes.doc 50.2 kB
  • Word 97-2003/conversation-cards-going-on-holiday6236.doc 103.4 kB
  • Word 97-2003/conversation-cards-questions1.doc 327.2 kB
  • Word 97-2003/conversation-intermediate.doc 73.7 kB
  • Word 97-2003/conversation-on-sports.doc 79.9 kB
  • Word 97-2003/conversation_corner.doc 1.5 MB
  • Word 97-2003/cookie-jar.doc 25.6 kB
  • Word 97-2003/cookie-monster-in-the-library-beg.doc 31.7 kB
  • Word 97-2003/cookie-monster-in-the-library-beg_001.doc 32.8 kB
  • Word 97-2003/cooking-vocabulary.doc 4.7 MB
  • Word 97-2003/copia-de-shakira.doc 23.0 kB
  • Word 97-2003/copia-de-wavin.doc 24.1 kB
  • Word 97-2003/copie-de-types-of-homes.doc 50.2 kB
  • Word 97-2003/cordless-phone.doc 22.0 kB
  • Word 97-2003/corpse-bride-worksheet.doc 696.8 kB
  • Word 97-2003/correct-mistakes.doc 25.1 kB
  • Word 97-2003/correct-the-lyrics-friends-will-be-friends.doc 31.2 kB
  • Word 97-2003/correct-the-sentences-with-can.doc 24.6 kB
  • Word 97-2003/correct-the-sentences.doc 38.4 kB
  • Word 97-2003/couldnt-practice.doc 759.3 kB
  • Word 97-2003/count-and-match.doc 2.2 MB
  • Word 97-2003/count-and-non-count-nouns.doc 31.7 kB
  • Word 97-2003/count-uncount-singularplural-nouns.doc 274.9 kB
  • Word 97-2003/count.doc 28.7 kB
  • Word 97-2003/count_001.doc 38.9 kB
  • Word 97-2003/countable-and-uncountable-2012.doc 425.5 kB
  • Word 97-2003/countable-and-uncountable-nouns-lesson-miracle.doc 3.6 MB
  • Word 97-2003/countable-and-uncountable-nouns.doc 47.1 kB
  • Word 97-2003/countable-nouns.doc 29.2 kB
  • Word 97-2003/countable-uncountable-flcards.doc 682.5 kB
  • Word 97-2003/countable-uncountable.doc 1.8 MB
  • Word 97-2003/countable-uncountable_001.doc 1.8 MB
  • Word 97-2003/countable-uncountable_002.doc 125.4 kB
  • Word 97-2003/countable.doc 250.9 kB
  • Word 97-2003/countable_uncountable.doc 61.4 kB
  • Word 97-2003/countables.doc 42.0 kB
  • Word 97-2003/countables_uncountables.doc 48.1 kB
  • Word 97-2003/countries-and-nationalities.doc 42.0 kB
  • Word 97-2003/countries-and-nationalities_001.doc 239.6 kB
  • Word 97-2003/countries-bingo.doc 104.4 kB
  • Word 97-2003/countries-nationalities-colors-flags-elementary.doc 1.5 MB
  • Word 97-2003/countries-wordsearch-key.doc 111.6 kB
  • Word 97-2003/countries.doc 145.4 kB
  • Word 97-2003/countries_001.doc 453.1 kB
  • Word 97-2003/countries_002.doc 160.8 kB
  • Word 97-2003/countries_and_nationalities.doc 163.3 kB
  • Word 97-2003/countries_and_nationalities_001.doc 163.3 kB
  • Word 97-2003/countriesnationalitiesflags.doc 54.3 kB
  • Word 97-2003/country.doc 294.9 kB
  • Word 97-2003/cp-assignment-paragraph-song.doc 65.0 kB
  • Word 97-2003/cpe-set-expressions.doc 28.7 kB
  • Word 97-2003/cpe1-rewriting-collocations-and-idioms-phrases.doc 34.8 kB
  • Word 97-2003/crawl.doc 85.0 kB
  • Word 97-2003/crime-and-punishment-handout.doc 195.1 kB
  • Word 97-2003/crime-idioms.doc 42.5 kB
  • Word 97-2003/cross-word-animals.doc 60.9 kB
  • Word 97-2003/crossriver.doc 117.8 kB
  • Word 97-2003/crossword.doc 91.1 kB
  • Word 97-2003/crossword_001.doc 55.3 kB
  • Word 97-2003/cry-wolf-simple-present.doc 636.9 kB
  • Word 97-2003/cryptogram-work.doc 26.1 kB
  • Word 97-2003/cultura-inglesa-video-lesson.doc 209.4 kB
  • Word 97-2003/current-affairs-us-may.doc 33.3 kB
  • Word 97-2003/curro-lolina-ok.doc 510.0 kB
  • Word 97-2003/cut-out-colours.doc 169.0 kB
  • Word 97-2003/cutting-edge-advanced-wordlist-module-1.doc 132.6 kB
  • Word 97-2003/cvc-reading-board-game.doc 188.4 kB
  • Word 97-2003/cvc_four_in_a_row.doc 57.3 kB
  • Word 97-2003/cw.doc 1.3 MB
  • Word 97-2003/czech-food-and-drink_eng.doc 36.9 kB
  • Word 97-2003/daily-activities.doc 152.6 kB
  • Word 97-2003/daily-activities_001.doc 224.8 kB
  • Word 97-2003/daily-habits-and-times.doc 205.8 kB
  • Word 97-2003/daily-routine-arnold.doc 1.4 MB
  • Word 97-2003/daily-routine-ask-your-friend.doc 393.2 kB
  • Word 97-2003/daily-routine-ask-your-friend_001.doc 392.2 kB
  • Word 97-2003/daily-routine-cards.doc 35.3 kB
  • Word 97-2003/daily-routine-esl.doc 446.0 kB
  • Word 97-2003/daily-routine.doc 23.0 kB
  • Word 97-2003/daily-routines-2009.doc 257.5 kB
  • Word 97-2003/daily-routines-2009_001.doc 256.0 kB
  • Word 97-2003/daily-routines-pictionary.doc 464.4 kB
  • Word 97-2003/daily-routines-poster.doc 444.4 kB
  • Word 97-2003/daily-routines-time.doc 193.0 kB
  • Word 97-2003/daily-routines-wh-questions-personal-pronouns.doc 149.5 kB
  • Word 97-2003/daily-routines-wordsearch.doc 320.5 kB
  • Word 97-2003/daily-routines.doc 392.2 kB
  • Word 97-2003/daily-routines_001.doc 164.4 kB
  • Word 97-2003/daily-routines_002.doc 500.7 kB
  • Word 97-2003/daily-routines_003.doc 272.9 kB
  • Word 97-2003/daily-routnes.doc 201.7 kB
  • Word 97-2003/daily_routine.doc 48.6 kB
  • Word 97-2003/daily_routine_001.doc 48.6 kB
  • Word 97-2003/damien-jurado-abilene-worksheet.doc 26.1 kB
  • Word 97-2003/dance-with-my-father.doc 373.8 kB
  • Word 97-2003/dating.doc 118.3 kB
  • Word 97-2003/days-flash.doc 293.4 kB
  • Word 97-2003/days-month-dates.doc 80.9 kB
  • Word 97-2003/days-of-the-week-poster.doc 175.6 kB
  • Word 97-2003/days.doc 210.4 kB
  • Word 97-2003/daysoftheweek.doc 31.7 kB
  • Word 97-2003/dealing-with-clothes-key.doc 570.9 kB
  • Word 97-2003/dear-deidre-students-copy.doc 35.8 kB
  • Word 97-2003/death_of_a_mother.doc 32.3 kB
  • Word 97-2003/death_of_a_mother_001.doc 32.3 kB
  • Word 97-2003/define_it_game.doc 47.6 kB
  • Word 97-2003/define_it_game_001.doc 47.6 kB
  • Word 97-2003/defining-relative-clauses.doc 83.5 kB
  • Word 97-2003/defining-words.doc 30.2 kB
  • Word 97-2003/definite-artickle.doc 101.4 kB
  • Word 97-2003/definite-article-use-and-omission.doc 160.8 kB
  • Word 97-2003/definitions.doc 50.2 kB
  • Word 97-2003/degrees-of-comparison-worksheets.doc 118.3 kB
  • Word 97-2003/degrees-of-comparison.doc 103.9 kB
  • Word 97-2003/degrees-of-comparison_001.doc 72.2 kB
  • Word 97-2003/degrees-of-the-adjectives.doc 92.7 kB
  • Word 97-2003/demi-lovato-the-gift-of-a-friend.doc 120.8 kB
  • Word 97-2003/demonstrative-lesson-form-5.doc 31.7 kB
  • Word 97-2003/depeche-mode.doc 176.6 kB
  • Word 97-2003/describe-a-lifestyle.doc 69.1 kB
  • Word 97-2003/describe-someone.doc 332.3 kB
  • Word 97-2003/describe-the-person-using-the-information-given.doc 849.9 kB
  • Word 97-2003/describe-your-bedroom.doc 103.4 kB
  • Word 97-2003/describe-yourself.doc 72.2 kB
  • Word 97-2003/DESCRIBE_YOUR_BEDROOM.doc 103.4 kB
  • Word 97-2003/describing-a-city.doc 36.4 kB
  • Word 97-2003/describing-appearance-beginer-flashcard.doc 111.1 kB
  • Word 97-2003/describing-clowns.doc 42.0 kB
  • Word 97-2003/describing-famous-people.doc 476.7 kB
  • Word 97-2003/describing-feelings.doc 446.5 kB
  • Word 97-2003/describing-people.doc 19.5 kB
  • Word 97-2003/describing-people_001.doc 100.9 kB
  • Word 97-2003/describing-people_002.doc 57.9 kB
  • Word 97-2003/describing-people_003.doc 481.8 kB
  • Word 97-2003/describing-people_adjectives_vocabulary-worksheet.doc 209.9 kB
  • Word 97-2003/describing_people.doc 287.2 kB
  • Word 97-2003/description-of-people_sulany.doc 77.8 kB
  • Word 97-2003/descriptive-writing.doc 30.7 kB
  • Word 97-2003/design-a-zoo.doc 65.5 kB
  • Word 97-2003/desp-house-s1-ep1-6.doc 2.2 MB
  • Word 97-2003/desperate-housewives-dvd.doc 26.1 kB
  • Word 97-2003/desperate-housewives.doc 119.8 kB
  • Word 97-2003/destinys-child-survivor-gap.doc 22.5 kB
  • Word 97-2003/devoir-am-3em-trim.doc 67.1 kB
  • Word 97-2003/dexter.doc 346.6 kB
  • Word 97-2003/diagnostic-text_2186-eso.doc 39.9 kB
  • Word 97-2003/dialogue-holidays.doc 33.3 kB
  • Word 97-2003/diary-of-a-bored-girl-pres-simple-pres-continuous.doc 748.5 kB
  • Word 97-2003/diccionario-vocabulario-grammar.doc 324.1 kB
  • Word 97-2003/dictionary-lesson.doc 726.5 kB
  • Word 97-2003/diego-forlan-worksheet.doc 66.0 kB
  • Word 97-2003/dinner-party.doc 58.4 kB
  • Word 97-2003/dinocare.doc 201.7 kB
  • Word 97-2003/dinosaur-qa.doc 33.8 kB
  • Word 97-2003/dinosaurs.doc 84.5 kB
  • Word 97-2003/diphthongs-ee-ea.doc 200.7 kB
  • Word 97-2003/direct-and-reported-speech-summary.doc 47.6 kB
  • Word 97-2003/direct-reported-speech-rephrasing.doc 74.8 kB
  • Word 97-2003/direct-speech.doc 128.5 kB
  • Word 97-2003/direct-to-reported-speech.doc 173.6 kB
  • Word 97-2003/direct_and_reported_speech.doc 152.6 kB
  • Word 97-2003/direct_and_reported_speech_001.doc 152.6 kB
  • Word 97-2003/discussion-questions.doc 111.1 kB
  • Word 97-2003/discussion.doc 54.8 kB
  • Word 97-2003/discussion_001.doc 54.8 kB
  • Word 97-2003/discussions_bedtime.doc 36.4 kB
  • Word 97-2003/discussions_bedtime_001.doc 36.4 kB
  • Word 97-2003/discussions_mobilephones.doc 32.8 kB
  • Word 97-2003/discussions_mobilephones_001.doc 32.8 kB
  • Word 97-2003/disjunctive-questions.doc 28.2 kB
  • Word 97-2003/distinguishing-past-simple-vs-present-perfect-pre.doc 30.2 kB
  • Word 97-2003/do-does.doc 184.3 kB
  • Word 97-2003/do-does_001.doc 310.3 kB
  • Word 97-2003/do-you-know-where-you.doc 33.8 kB
  • Word 97-2003/do-you-like-school-s2.doc 142.3 kB
  • Word 97-2003/do-you-practice-any-sport.doc 184.8 kB
  • Word 97-2003/do_make.doc 249.9 kB
  • Word 97-2003/doc1.doc 152.6 kB
  • Word 97-2003/doc1_001.doc 771.6 kB
  • Word 97-2003/doc1_002.doc 26.6 kB
  • Word 97-2003/dog_related_voc.doc 90.1 kB
  • Word 97-2003/doingthehousework1likesanddislikeseg10.doc 27.1 kB
  • Word 97-2003/doingthehousework1likesanddislikeseg10_001.doc 27.1 kB
  • Word 97-2003/dokument-microsoft-office-word-97-2003-10.doc 107.5 kB
  • Word 97-2003/dokument-microsoft-office-word-97-2003-2.doc 198.1 kB
  • Word 97-2003/dokument-microsoft-office-word-97-2003-3.doc 128.5 kB
  • Word 97-2003/dokument-microsoft-office-word-97-2003-3_001.doc 537.1 kB
  • Word 97-2003/dokument-microsoft-office-word-97-2003-3_002.doc 537.1 kB
  • Word 97-2003/dokument-microsoft-office-word-97-2003-4.doc 79.9 kB
  • Word 97-2003/dokument-microsoft-office-word-97-2003-5.doc 6.1 MB
  • Word 97-2003/dokument-microsoft-office-word-97-2003-9.doc 2.9 MB
  • Word 97-2003/dokument-microsoft-office-word-97-2003.doc 225.3 kB
  • Word 97-2003/dokument-microsoft-office-word-97-2003_001.doc 386.6 kB
  • Word 97-2003/dokument-microsoft-office-word-97-2003_002.doc 268.8 kB
  • Word 97-2003/dokument-microsoft-word-2.doc 41.0 kB
  • Word 97-2003/dokument-microsoft-word-3.doc 113.7 kB
  • Word 97-2003/dokument-microsoft-word.doc 180.2 kB
  • Word 97-2003/dokument-microsoft-word_001.doc 86.5 kB
  • Word 97-2003/dokument-microsoft-word_002.doc 820.2 kB
  • Word 97-2003/dokument-microsoft-word_003.doc 20.0 kB
  • Word 97-2003/dokument-microsoft-word_004.doc 1.2 MB
  • Word 97-2003/domingo_11nov.doc 327.2 kB
  • Word 97-2003/domino-a-an.doc 1.8 MB
  • Word 97-2003/domino.doc 418.3 kB
  • Word 97-2003/domino_animals.doc 128.0 kB
  • Word 97-2003/dominoes.doc 93.7 kB
  • Word 97-2003/donto_feladatai-zsuri.doc 612.4 kB
  • Word 97-2003/dopersonal-pronouns-verb-to-be-possessive.doc 454.1 kB
  • Word 97-2003/dorooms-in-the-house-2012.doc 165.9 kB
  • Word 97-2003/dorooms-in-the-house-2012_001.doc 165.9 kB
  • Word 97-2003/doyouhearwhatihear.doc 90.6 kB
  • Word 97-2003/Dr_English.doc 148.5 kB
  • Word 97-2003/draw-the-seaside.doc 28.7 kB
  • Word 97-2003/dream-house-by-hicham-from-morocco.doc 7.5 MB
  • Word 97-2003/drinks.doc 280.1 kB
  • Word 97-2003/drinks_001.doc 280.1 kB
  • Word 97-2003/drops-of-jupiter1.doc 32.8 kB
  • Word 97-2003/dumb-ways-to-die.doc 194.6 kB
  • Word 97-2003/dumb-ways-to-die_001.doc 194.6 kB
  • Word 97-2003/duplex-activities.doc 153.6 kB
  • Word 97-2003/e-c-c-e-speaking-test-r.doc 47.1 kB
  • Word 97-2003/e-mails.doc 69.1 kB
  • Word 97-2003/e-n-g-l-i-s-h-f-o-r-s-m-s.doc 24.6 kB
  • Word 97-2003/eachother.doc 225.3 kB
  • Word 97-2003/earthquake_vs_volcano.doc 69.6 kB
  • Word 97-2003/easter-picture-dictionary.doc 331.8 kB
  • Word 97-2003/easter-trivia-quiz.doc 101.4 kB
  • Word 97-2003/easter-worksheet.doc 315.9 kB
  • Word 97-2003/easter.doc 828.4 kB
  • Word 97-2003/easter_001.doc 211.5 kB
  • Word 97-2003/easy-planets.doc 245.2 kB
  • Word 97-2003/easy-verb-grid-_-pres-tense.doc 60.4 kB
  • Word 97-2003/eating-habits.doc 267.8 kB
  • Word 97-2003/eating-out-ws.doc 76.3 kB
  • Word 97-2003/eating.doc 222.2 kB
  • Word 97-2003/eating_reading.doc 225.3 kB
  • Word 97-2003/ecce-essay-writing.doc 39.9 kB
  • Word 97-2003/eclipse-1.doc 336.4 kB
  • Word 97-2003/ecotourism-in-bolivia-busy-teacher.doc 34.3 kB
  • Word 97-2003/ed-ing-adjectives.doc 38.4 kB
  • Word 97-2003/education-in-australia.doc 39.4 kB
  • Word 97-2003/efl.doc 1.9 MB
  • Word 97-2003/eflpreint-test-u9-16.doc 36.4 kB
  • Word 97-2003/ego-song-activity-gradable-adjectives.doc 30.2 kB
  • Word 97-2003/ego-song-activity.doc 29.7 kB
  • Word 97-2003/egyszer369-vs-foly.doc 28.7 kB
  • Word 97-2003/el-ponchis-1-hunted-summary.doc 39.9 kB
  • Word 97-2003/el-ponchis-2-captured.doc 464.9 kB
  • Word 97-2003/el-ponchis-3-tried-and-convicted.doc 140.8 kB
  • Word 97-2003/elementary-exercise.doc 40.4 kB
  • Word 97-2003/elementary-exercise_001.doc 40.4 kB
  • Word 97-2003/elementary-students-emotions-activities.doc 31.7 kB
  • Word 97-2003/elementarytest.doc 183.3 kB
  • Word 97-2003/elevation-by-u2-song.doc 26.1 kB
  • Word 97-2003/elvis-presley.doc 41.5 kB
  • Word 97-2003/elvis.doc 49.7 kB
  • Word 97-2003/emergency.doc 122.4 kB
  • Word 97-2003/emotionalmemories-2.doc 32.3 kB
  • Word 97-2003/emotions-map.doc 191.5 kB
  • Word 97-2003/emotions.doc 54.3 kB
  • Word 97-2003/empire-state-of-mind.doc 36.4 kB
  • Word 97-2003/endangered-animals.doc 506.4 kB
  • Word 97-2003/endangered_species.doc 37.9 kB
  • Word 97-2003/english-chart.doc 484.9 kB
  • Word 97-2003/english-for-human-resources.doc 300.5 kB
  • Word 97-2003/english-lessons-are.doc 143.9 kB
  • Word 97-2003/english-proverbs-1.doc 25.6 kB
  • Word 97-2003/english-proverbs-2.doc 25.1 kB
  • Word 97-2003/english-quiz.doc 42.5 kB
  • Word 97-2003/english-test-basic.doc 39.9 kB
  • Word 97-2003/english-test-basic_001.doc 44.0 kB
  • Word 97-2003/english-today-test.doc 79.9 kB
  • Word 97-2003/english-town-information-gap-game.doc 256.0 kB
  • Word 97-2003/english-word.doc 422.9 kB
  • Word 97-2003/english-worksheet-past-simple-wh-questions-1.doc 44.5 kB
  • Word 97-2003/english-worksheet-past-simple-wh-questions.doc 44.0 kB
  • Word 97-2003/english-worksheet-telling-time.doc 31.7 kB
  • Word 97-2003/english.doc 28.7 kB
  • Word 97-2003/english_quiz_the-english-speaking-world.doc 150.4 kB
  • Word 97-2003/englishfarmdice.doc 4.6 MB
  • Word 97-2003/englishproverbs.doc 49.7 kB
  • Word 97-2003/englishtes1.doc 196.1 kB
  • Word 97-2003/englishtest.doc 29.7 kB
  • Word 97-2003/enter.doc 27.1 kB
  • Word 97-2003/entry-test.doc 112.6 kB
  • Word 97-2003/env.doc 170.0 kB
  • Word 97-2003/environment-and-ecology.doc 1.8 MB
  • Word 97-2003/environment-cw-2003.doc 289.3 kB
  • Word 97-2003/environment-voc-st-2003.doc 378.4 kB
  • Word 97-2003/environment_protection_quiz.doc 39.9 kB
  • Word 97-2003/environment_protection_quiz_001.doc 39.9 kB
  • Word 97-2003/environmental-pollution.doc 294.9 kB
  • Word 97-2003/episode-3-season-3-bt.doc 381.4 kB
  • Word 97-2003/error-correction.doc 89.6 kB
  • Word 97-2003/esl-2.doc 510.5 kB
  • Word 97-2003/esl-key.doc 75.8 kB
  • Word 97-2003/esl.doc 82.9 kB
  • Word 97-2003/esl_001.doc 75.8 kB
  • Word 97-2003/eslprintables200811615755216751953.doc 73.7 kB
  • Word 97-2003/eslprintables200812283537612122491.doc 234.0 kB
  • Word 97-2003/eslprintables2008615102240561037524.doc 219.6 kB
  • Word 97-2003/eslprintables2008668303464457467.doc 176.1 kB
  • Word 97-2003/eslprintables201012205130839699668.doc 124.9 kB
  • Word 97-2003/esol-verb-be-conjugations.doc 35.8 kB
  • Word 97-2003/essays-made-easy.doc 30.2 kB
  • Word 97-2003/estudios_generales_4.doc 1.2 MB
  • Word 97-2003/et-futurist-lover-exercise.doc 26.1 kB
  • Word 97-2003/ethnologue-ul-activity.doc 28.7 kB
  • Word 97-2003/etiquette.doc 49.2 kB
  • Word 97-2003/eurovision-2011-worksheet.doc 87.6 kB
  • Word 97-2003/evanescence.doc 98.3 kB
  • Word 97-2003/every-breath-you-take-the-police.doc 56.3 kB
  • Word 97-2003/every1-is-unique2.doc 138.2 kB
  • Word 97-2003/everyday-expressions.doc 76.8 kB
  • Word 97-2003/everything-you-want-exercises.doc 348.2 kB
  • Word 97-2003/evian-roller-babies-comp.doc 172.5 kB
  • Word 97-2003/exam-ist-term-tenses.doc 39.4 kB
  • Word 97-2003/exam1.doc 72.2 kB
  • Word 97-2003/exam_20072008.doc 112.6 kB
  • Word 97-2003/exam_20072008_001.doc 112.6 kB
  • Word 97-2003/examene_i_2009.doc 165.9 kB
  • Word 97-2003/exercise-adverbs-of-degree.doc 20.0 kB
  • Word 97-2003/exercise-farm-2nd-form.doc 251.4 kB
  • Word 97-2003/exercise-my-big-regret.doc 19.5 kB
  • Word 97-2003/exercise.doc 1.1 MB
  • Word 97-2003/exercise_bridge-of-light.doc 26.1 kB
  • Word 97-2003/exercises-future-tense.doc 28.7 kB
  • Word 97-2003/exercises-may-and-might.doc 116.2 kB
  • Word 97-2003/exercises-on-conjunctions.doc 27.6 kB
  • Word 97-2003/exercises-on-some-or-any.doc 90.1 kB
  • Word 97-2003/exercises-used-to.doc 70.1 kB
  • Word 97-2003/exercises_will_future.doc 25.6 kB
  • Word 97-2003/experimental-travel.doc 487.9 kB
  • Word 97-2003/explain-yourself-warm-up.doc 87.6 kB
  • Word 97-2003/explain-yourself-warm-up_001.doc 73.7 kB
  • Word 97-2003/explain-yourself-warm-up_002.doc 73.7 kB
  • Word 97-2003/explaining-dishes-photos-texte-lacunaire2.doc 1.2 MB
  • Word 97-2003/expression-orale.doc 146.9 kB
  • Word 97-2003/expressions-with-do.doc 219.1 kB
  • Word 97-2003/expressions-with-make.doc 169.5 kB
  • Word 97-2003/f2-thurs-28-feb.doc 448.0 kB
  • Word 97-2003/face-test.doc 49.7 kB
  • Word 97-2003/face.doc 36.4 kB
  • Word 97-2003/face_001.doc 36.4 kB
  • Word 97-2003/facebook-creator-is-time-person-of-the-year.doc 103.4 kB
  • Word 97-2003/faces.doc 45.1 kB
  • Word 97-2003/factfamilyhouses.doc 27.6 kB
  • Word 97-2003/facts-about-mother-russia.doc 92.2 kB
  • Word 97-2003/fairy-tale-characters.doc 362.0 kB
  • Word 97-2003/fairy-tales-board-game-final.doc 51.2 kB
  • Word 97-2003/fairy-tales-flash.doc 255.5 kB
  • Word 97-2003/false-friends-game.doc 505.9 kB
  • Word 97-2003/families-and-relationships.doc 34.3 kB
  • Word 97-2003/families1.doc 45.6 kB
  • Word 97-2003/family-2.doc 530.4 kB
  • Word 97-2003/family-by-me.doc 392.2 kB
  • Word 97-2003/family-cards.doc 110.1 kB
  • Word 97-2003/family-crossword.doc 118.8 kB
  • Word 97-2003/family-crossword_easy.doc 596.5 kB
  • Word 97-2003/family-life.doc 38.9 kB
  • Word 97-2003/family-members-simpsons.doc 85.0 kB
  • Word 97-2003/family-portrait.doc 24.1 kB
  • Word 97-2003/family-text.doc 33.3 kB
  • Word 97-2003/family-the-simpsons.doc 218.1 kB
  • Word 97-2003/family-tree-activity.doc 78.3 kB
  • Word 97-2003/family-tree-eng.doc 22.5 kB
  • Word 97-2003/family-tree-worksheet.doc 34.3 kB
  • Word 97-2003/family-tree.doc 41.0 kB
  • Word 97-2003/family-tree_001.doc 265.2 kB
  • Word 97-2003/family-vocabpossessive-s.doc 134.1 kB
  • Word 97-2003/family-worksheet.doc 1.0 MB
  • Word 97-2003/family.doc 179.7 kB
  • Word 97-2003/family_001.doc 162.3 kB
  • Word 97-2003/family_002.doc 44.5 kB
  • Word 97-2003/family_003.doc 452.6 kB
  • Word 97-2003/famous-british-landmarks.doc 1.2 MB
  • Word 97-2003/famous-british-peope.doc 1.4 MB
  • Word 97-2003/famous-couples-in-british-literature.doc 43.0 kB
  • Word 97-2003/famous-nationalities_colors.doc 266.2 kB
  • Word 97-2003/famous-people-cards.doc 221.7 kB
  • Word 97-2003/famous-people-crossword.doc 25.1 kB
  • Word 97-2003/famous-people.doc 33.8 kB
  • Word 97-2003/famous-people_001.doc 60.9 kB
  • Word 97-2003/famous-people_002.doc 30.7 kB
  • Word 97-2003/famousartists.doc 1.1 MB
  • Word 97-2003/fantasy.doc 271.9 kB
  • Word 97-2003/farm-animals-98.doc 586.8 kB
  • Word 97-2003/farm-animals-co-multiple-choice.doc 404.5 kB
  • Word 97-2003/farm-animals.doc 267.3 kB
  • Word 97-2003/farm-animals_001.doc 145.4 kB
  • Word 97-2003/farm-concert.doc 73.7 kB
  • Word 97-2003/farmanimals.doc 416.3 kB
  • Word 97-2003/fashion-quiz.doc 462.8 kB
  • Word 97-2003/fast-food.doc 55.3 kB
  • Word 97-2003/favorite-pastimes-bingo-sheet.doc 168.4 kB
  • Word 97-2003/favourite.doc 273.9 kB
  • Word 97-2003/fawlty-towers-season-one-worksheets.doc 31.7 kB
  • Word 97-2003/fawlty-towers.doc 25.1 kB
  • Word 97-2003/fawlty-towers_1_.doc 36.9 kB
  • Word 97-2003/fb-colours.doc 438.3 kB
  • Word 97-2003/fc-opposites.doc 5.7 MB
  • Word 97-2003/fcards_july-4th_a4.doc 401.4 kB
  • Word 97-2003/fce-crossword.doc 33.8 kB
  • Word 97-2003/fce-test.doc 35.3 kB
  • Word 97-2003/feelings-01.doc 54.8 kB
  • Word 97-2003/feelings-and-emotions.doc 35.3 kB
  • Word 97-2003/feelings-and-needs.doc 182.3 kB
  • Word 97-2003/feelings.doc 304.6 kB
  • Word 97-2003/feelings_001.doc 23.0 kB
  • Word 97-2003/feelings_002.doc 255.0 kB
  • Word 97-2003/feelings_003.doc 175.1 kB
  • Word 97-2003/ferris-bueller.doc 138.8 kB
  • Word 97-2003/ferris_bueller.doc 138.8 kB
  • Word 97-2003/festival-in-peru-1.doc 2.1 MB
  • Word 97-2003/ficha_reported_sp.doc 37.4 kB
  • Word 97-2003/ficha_reported_sp_001.doc 37.4 kB
  • Word 97-2003/fiche-prof-manners.doc 38.9 kB
  • Word 97-2003/fictional-text.doc 1.0 MB
  • Word 97-2003/fill-in-one.doc 25.1 kB
  • Word 97-2003/fill-in-the-blanks-18.doc 103.4 kB
  • Word 97-2003/fill-in-the-gaps-the-notebook.doc 188.4 kB
  • Word 97-2003/fill-in.doc 86.0 kB
  • Word 97-2003/fill-the-blanks-with-the-right-form-of-the.doc 25.6 kB
  • Word 97-2003/filling-in-the-form.doc 35.3 kB
  • Word 97-2003/film-types-worksheet.doc 24.6 kB
  • Word 97-2003/final-review-advanced.doc 43.0 kB
  • Word 97-2003/final-test-kids-mag1.doc 857.6 kB
  • Word 97-2003/final-test4.doc 196.1 kB
  • Word 97-2003/final-test_ovidiu.doc 33.3 kB
  • Word 97-2003/final_edses.doc 252.4 kB
  • Word 97-2003/final_edses_001.doc 252.4 kB
  • Word 97-2003/find-40-farm-animals.doc 357.9 kB
  • Word 97-2003/find-40-sports.doc 409.6 kB
  • Word 97-2003/find-40-verbs-2.doc 414.7 kB
  • Word 97-2003/find-40-verbs.doc 484.9 kB
  • Word 97-2003/find-letter-color.doc 222.2 kB
  • Word 97-2003/find-someone-who-after-summer-holidays.doc 2.2 MB
  • Word 97-2003/find-someone-who-disasters.doc 44.5 kB
  • Word 97-2003/find-someone-who-general-with-points.doc 42.0 kB
  • Word 97-2003/find-someone-who-mixed-tenses.doc 25.6 kB
  • Word 97-2003/find-someone-who-winter-vacation-2011-version-3.doc 111.1 kB
  • Word 97-2003/find-the-homophones.doc 23.6 kB
  • Word 97-2003/find-words.doc 36.9 kB
  • Word 97-2003/find-your-peer-warm-up-activity.doc 41.5 kB
  • Word 97-2003/fire-fire.doc 233.0 kB
  • Word 97-2003/fire-fire2.doc 216.1 kB
  • Word 97-2003/fireflies.doc 206.8 kB
  • Word 97-2003/firends-season-2-episode-8-the-one-with-the-list.doc 37.9 kB
  • Word 97-2003/firends-season-2-episode-8-the-one-with-the-list_001.doc 40.4 kB
  • Word 97-2003/firework-katy-perry.doc 480.8 kB
  • Word 97-2003/fireworks-by-katy-perry_2003.doc 28.2 kB
  • Word 97-2003/first-conditional-2012.doc 1.1 MB
  • Word 97-2003/first-conditional.doc 164.4 kB
  • Word 97-2003/first-day-games.doc 57.9 kB
  • Word 97-2003/first-term-english-exam-for-ms3.doc 91.6 kB
  • Word 97-2003/fitxa-menu.doc 116.7 kB
  • Word 97-2003/flags-and-nationalities.doc 121.9 kB
  • Word 97-2003/flashcards-identities.doc 1.6 MB
  • Word 97-2003/flashcards-medicine.doc 7.3 MB
  • Word 97-2003/flashforward-episode-1-with-key.doc 44.0 kB
  • Word 97-2003/flatmate-interview-question-activity.doc 141.3 kB
  • Word 97-2003/flora-fauna.doc 1.5 MB
  • Word 97-2003/flowers.doc 93.2 kB
  • Word 97-2003/fly-nicky-minaj.doc 20.0 kB
  • Word 97-2003/food-2.doc 154.1 kB
  • Word 97-2003/food-and-drinks-many.doc 159.7 kB
  • Word 97-2003/food-and-drinks.doc 73.2 kB
  • Word 97-2003/food-countable-and-uncountable-nouns-quantifiers.doc 158.7 kB
  • Word 97-2003/food-dislikes.doc 129.0 kB
  • Word 97-2003/food-les-25-role-play.doc 440.3 kB
  • Word 97-2003/food-matching.doc 409.6 kB
  • Word 97-2003/food-pictio.doc 748.5 kB
  • Word 97-2003/food.doc 999.4 kB
  • Word 97-2003/food_001.doc 153.1 kB
  • Word 97-2003/food_002.doc 562.2 kB
  • Word 97-2003/food_003.doc 110.1 kB
  • Word 97-2003/food_004.doc 114.7 kB
  • Word 97-2003/food_005.doc 693.8 kB
  • Word 97-2003/food_con_cards.doc 36.4 kB
  • Word 97-2003/foolin_alex_rybak.doc 21.0 kB
  • Word 97-2003/for-and-since-for-time.doc 34.8 kB
  • Word 97-2003/for-and-since.doc 33.8 kB
  • Word 97-2003/for-worksheets.doc 33.8 kB
  • Word 97-2003/form-of-the-s305mple-present.doc 33.3 kB
  • Word 97-2003/formaci_n_de_plurales.doc 22.5 kB
  • Word 97-2003/formal-vs-informal-chart.doc 39.4 kB
  • Word 97-2003/formal_letter.doc 106.0 kB
  • Word 97-2003/formal_letter_001.doc 106.0 kB
  • Word 97-2003/formal_letter_teachers.doc 68.6 kB
  • Word 97-2003/formal_letter_teachers_001.doc 68.6 kB
  • Word 97-2003/foror-since.doc 39.4 kB
  • Word 97-2003/fortune-teller2.doc 85.5 kB
  • Word 97-2003/fountain-pens.doc 61.4 kB
  • Word 97-2003/four-jobs1.doc 185.9 kB
  • Word 97-2003/four-jobs2.doc 165.9 kB
  • Word 97-2003/four-jobs3.doc 190.0 kB
  • Word 97-2003/fourseasons.doc 511.0 kB
  • Word 97-2003/fragment.doc 157.7 kB
  • Word 97-2003/frazovye-glagoly.doc 49.7 kB
  • Word 97-2003/frequency-activity-card.doc 267.3 kB
  • Word 97-2003/frequency-adverbs.doc 134.7 kB
  • Word 97-2003/friends-episode-2-season-1.doc 42.5 kB
  • Word 97-2003/friends-reportedspeech.doc 63.5 kB
  • Word 97-2003/friends-role-play.doc 24.1 kB
  • Word 97-2003/friends-season-2-episode-10-the-one-with-the-russ.doc 35.8 kB
  • Word 97-2003/friends-season-2-episode-11-the-one-with-the.doc 53.2 kB
  • Word 97-2003/friends-season-2-episode-12.doc 282.1 kB
  • Word 97-2003/friends-season-2-episode-14.doc 67.1 kB
  • Word 97-2003/friends-season-2-episode-16.doc 205.8 kB
  • Word 97-2003/friends-season-2-episode-9-the-one-with-phoebes.doc 218.1 kB
  • Word 97-2003/friends-season-2-episode-9-the-one-with-phoebes_001.doc 212.0 kB
  • Word 97-2003/friends-video-session-joey-and-ross-dating-the.doc 1.4 MB
  • Word 97-2003/friends-video-session-joey-and-ross-dating-the_001.doc 1.5 MB
  • Word 97-2003/frog-cycle.doc 32.8 kB
  • Word 97-2003/fruit-and-colours.doc 180.7 kB
  • Word 97-2003/fruit-and-vegetables.doc 479.2 kB
  • Word 97-2003/fruit-flash.doc 298.4 kB
  • Word 97-2003/fruit.doc 137.7 kB
  • Word 97-2003/fruits-activity.doc 264.7 kB
  • Word 97-2003/fruits-and-vegetables.doc 530.9 kB
  • Word 97-2003/fruits-vegetables.doc 209.4 kB
  • Word 97-2003/fruits.doc 268.8 kB
  • Word 97-2003/fruitsvegetables.doc 628.2 kB
  • Word 97-2003/fs1-oral-partiel-first-semester-2012.doc 28.2 kB
  • Word 97-2003/fs_and_ks1_stickers.doc 598.0 kB
  • Word 97-2003/fun-with-compound-words.doc 174.1 kB
  • Word 97-2003/functions-in-english.doc 203.3 kB
  • Word 97-2003/functions-of-money.doc 526.8 kB
  • Word 97-2003/funfacts.doc 31.7 kB
  • Word 97-2003/funny.doc 64.5 kB
  • Word 97-2003/furniture.doc 495.6 kB
  • Word 97-2003/furniture_001.doc 268.8 kB
  • Word 97-2003/furniture_002.doc 399.9 kB
  • Word 97-2003/furniture_003.doc 185.9 kB
  • Word 97-2003/furniture_004.doc 105.5 kB
  • Word 97-2003/furniture_worksheet_full.doc 201.7 kB
  • Word 97-2003/future-2012.doc 923.1 kB
  • Word 97-2003/future-career.doc 302.1 kB
  • Word 97-2003/future-continuous.doc 127.0 kB
  • Word 97-2003/future-forms.doc 229.9 kB
  • Word 97-2003/future-i-simple-going-to-pres-cont-int.doc 2.3 MB
  • Word 97-2003/future-indefinite-1.doc 33.3 kB
  • Word 97-2003/future-perfect.doc 115.2 kB
  • Word 97-2003/future-simple-for-predictions.doc 120.8 kB
  • Word 97-2003/future-simple.doc 112.1 kB
  • Word 97-2003/future-simple_001.doc 238.1 kB
  • Word 97-2003/future-simple_002.doc 112.1 kB
  • Word 97-2003/future-tense.doc 101.9 kB
  • Word 97-2003/future-time-clauses.doc 45.6 kB
  • Word 97-2003/future-will-going-to-present-continuous.doc 110.1 kB
  • Word 97-2003/future-will.doc 195.1 kB
  • Word 97-2003/future.doc 138.2 kB
  • Word 97-2003/future_worksheet.doc 413.7 kB
  • Word 97-2003/g-force.doc 351.7 kB
  • Word 97-2003/g5grammar.doc 49.7 kB
  • Word 97-2003/game-adjectives.doc 49.7 kB
  • Word 97-2003/game-tense-review.doc 54.3 kB
  • Word 97-2003/game.doc 23.0 kB
  • Word 97-2003/game_001.doc 755.7 kB
  • Word 97-2003/game_board_pics_1.doc 98.3 kB
  • Word 97-2003/gameboard-45-cards.doc 259.6 kB
  • Word 97-2003/gameboard-conversation.doc 507.4 kB
  • Word 97-2003/gameboard-short-vowels.doc 110.1 kB
  • Word 97-2003/games-in-the-park.doc 81.9 kB
  • Word 97-2003/games_on_numbers.doc 115.7 kB
  • Word 97-2003/games_on_numbers_001.doc 115.7 kB
  • Word 97-2003/gamesfreetimebga4.doc 35.3 kB
  • Word 97-2003/gamesfreetimebga4_001.doc 35.3 kB
  • Word 97-2003/gap-year-1.doc 30.2 kB
  • Word 97-2003/garage.doc 182.3 kB
  • Word 97-2003/gary-video-sheet.doc 5.5 kB
  • Word 97-2003/genitives.doc 114.2 kB
  • Word 97-2003/genre-book-cover-project-12sep12.doc 152.6 kB
  • Word 97-2003/geography-quiz.doc 30.2 kB
  • Word 97-2003/georges-auguste-escoffier.doc 294.4 kB
  • Word 97-2003/gerund-infinitive-exercise.doc 52.2 kB
  • Word 97-2003/gerund-or-infinitive-key.doc 283.1 kB
  • Word 97-2003/gerund-or-infinitive-review.doc 246.3 kB
  • Word 97-2003/gerund-or-infinitive.doc 24.6 kB
  • Word 97-2003/gerund-or-infinitive_001.doc 39.4 kB
  • Word 97-2003/gerund-vs-infinitive.doc 20.0 kB
  • Word 97-2003/gerund.doc 37.4 kB
  • Word 97-2003/gerund_001.doc 33.3 kB
  • Word 97-2003/gerunds-and-infinitives.doc 44.0 kB
  • Word 97-2003/gerunds-and-infinitives_001.doc 103.4 kB
  • Word 97-2003/gerunds-and-infinitives_002.doc 35.8 kB
  • Word 97-2003/gerunds-and-infinitives_popurri.doc 51.7 kB
  • Word 97-2003/gesturepractice2.doc 88.1 kB
  • Word 97-2003/gestures.doc 67.1 kB
  • Word 97-2003/gestures_001.doc 241.2 kB
  • Word 97-2003/get-four.doc 60.9 kB
  • Word 97-2003/getting-to-know-your-classmates-superlatives.doc 34.3 kB
  • Word 97-2003/gift-giving-culture-quiz.doc 279.0 kB
  • Word 97-2003/gift-giving-mistakes.doc 647.2 kB
  • Word 97-2003/gift-giving-quotes.doc 3.1 MB
  • Word 97-2003/gifted-hands2.doc 54.8 kB
  • Word 97-2003/give-personal-information.doc 55.3 kB
  • Word 97-2003/give-the-plural-of-the-following-nouns.doc 68.6 kB
  • Word 97-2003/give-your-advice.doc 20.5 kB
  • Word 97-2003/giving-advice.doc 77.3 kB
  • Word 97-2003/giving-advice_001.doc 24.6 kB
  • Word 97-2003/giving-advice_cards_2013.doc 35.3 kB
  • Word 97-2003/giving-directions-places-in-town.doc 219.1 kB
  • Word 97-2003/giving-directions.doc 267.3 kB
  • Word 97-2003/giving-opinions.doc 31.7 kB
  • Word 97-2003/glad-you-came1.doc 37.9 kB
  • Word 97-2003/glee-brittany-x-britney.doc 2.1 MB
  • Word 97-2003/god-save-the-queen.doc 39.4 kB
  • Word 97-2003/going-house-hunting.doc 85.5 kB
  • Word 97-2003/going-to-2013.doc 180.7 kB
  • Word 97-2003/going-to-future-diary-entry-act.doc 32.2 kB
  • Word 97-2003/going-to-vs-will.doc 200.2 kB
  • Word 97-2003/going-to-vs-will_001.doc 200.2 kB
  • Word 97-2003/going-to.doc 131.6 kB
  • Word 97-2003/going-to_001.doc 252.9 kB
  • Word 97-2003/going-to_002.doc 120.8 kB
  • Word 97-2003/going-to_003.doc 246.3 kB
  • Word 97-2003/golden-grammar-rules.doc 76.3 kB
  • Word 97-2003/goldilocks-and-the-three-bears.doc 26.1 kB
  • Word 97-2003/gotye-somebody-i-used-to-know.doc 65.5 kB
  • Word 97-2003/gotye.doc 29.2 kB
  • Word 97-2003/gra-planszowa1a-c.doc 329.2 kB
  • Word 97-2003/gra-planszowa1a-c_001.doc 329.2 kB
  • Word 97-2003/graffiti.doc 45.1 kB
  • Word 97-2003/grammar-and-vocab-test-for-esl-learners.doc 41.0 kB
  • Word 97-2003/grammar-auction.doc 24.6 kB
  • Word 97-2003/grammar-be-going-to.doc 444.9 kB
  • Word 97-2003/grammar-present-simple.doc 39.4 kB
  • Word 97-2003/grammar-present-simple_001.doc 37.9 kB
  • Word 97-2003/grammar-present-simple_002.doc 93.2 kB
  • Word 97-2003/grammar-review_past_comparative.doc 41.0 kB
  • Word 97-2003/grammar-superlative-and-other-comparative-forms.doc 42.0 kB
  • Word 97-2003/grammar-test-1.doc 444.4 kB
  • Word 97-2003/grammar-test.doc 218.1 kB
  • Word 97-2003/grammar-test_001.doc 439.8 kB
  • Word 97-2003/grammar-unit-1-enterprise-i.doc 117.8 kB
  • Word 97-2003/grammar-unit-2-enterprise-i.doc 73.7 kB
  • Word 97-2003/grammar.doc 1.9 MB
  • Word 97-2003/grammar_001.doc 260.1 kB
  • Word 97-2003/grammar_hunt.doc 25.6 kB
  • Word 97-2003/grammar_possessiveclitic.doc 100.9 kB
  • Word 97-2003/grammarwhquestions_game.doc 27.6 kB
  • Word 97-2003/great-explorers-mine.doc 306.7 kB
  • Word 97-2003/great-people-matching.doc 185.3 kB
  • Word 97-2003/greetings.doc 389.1 kB
  • Word 97-2003/greetings_manners_conversation.doc 38.9 kB
  • Word 97-2003/groundhogs-day-new.doc 1.1 MB
  • Word 97-2003/group-study-guide-for.doc 340.5 kB
  • Word 97-2003/growing-up.doc 42.0 kB
  • Word 97-2003/guess-the-colours.doc 108.0 kB
  • Word 97-2003/guess-the-title.doc 56.8 kB
  • Word 97-2003/guess-who.doc 1.7 MB
  • Word 97-2003/guessing-game-example-m-l-king-portraits.doc 176.1 kB
  • Word 97-2003/guia-b1final.doc 22.0 kB
  • Word 97-2003/guia-extra-clase-1.doc 191.5 kB
  • Word 97-2003/guide-simple-past.doc 413.2 kB
  • Word 97-2003/gym-act.doc 160.8 kB
  • Word 97-2003/habitats-and-animals-around-the-world.doc 341.0 kB
  • Word 97-2003/habits.doc 23.0 kB
  • Word 97-2003/habits_001.doc 23.0 kB
  • Word 97-2003/hair-stylesdescriptions.doc 272.9 kB
  • Word 97-2003/halloween-fingers-counter.doc 838.7 kB
  • Word 97-2003/halloween-fun.doc 109.6 kB
  • Word 97-2003/halloween-haunted-house-draw.doc 250.4 kB
  • Word 97-2003/halloween-matching.doc 384.0 kB
  • Word 97-2003/halloween-pictionary.doc 243.2 kB
  • Word 97-2003/halloween-wordsearch-puzzle-colour.doc 149.0 kB
  • Word 97-2003/halloween-wordsearch-puzzle.doc 210.9 kB
  • Word 97-2003/halloween.doc 130.6 kB
  • Word 97-2003/halloween_001.doc 157.2 kB
  • Word 97-2003/halloween_002.doc 193.0 kB
  • Word 97-2003/halloween_003.doc 478.7 kB
  • Word 97-2003/halloween_004.doc 652.8 kB
  • Word 97-2003/halloween_005.doc 159.2 kB
  • Word 97-2003/halloween_006.doc 186.9 kB
  • Word 97-2003/halloween_cloze.doc 65.0 kB
  • Word 97-2003/Halloween_cloze_001.doc 65.0 kB
  • Word 97-2003/halloween_crossword1.doc 417.8 kB
  • Word 97-2003/halloween_crossword1_001.doc 417.8 kB
  • Word 97-2003/halloween_present-simple_2012.doc 193.5 kB
  • Word 97-2003/halloweencloze.doc 132.6 kB
  • Word 97-2003/halloweencloze_001.doc 132.6 kB
  • Word 97-2003/halloweencloze_002.doc 158.2 kB
  • Word 97-2003/hand-in-my-pocket-alanis-morisetti-ex.doc 170.0 kB
  • Word 97-2003/handout_numbers.doc 96.8 kB
  • Word 97-2003/happiness-picture.doc 1.5 MB
  • Word 97-2003/happiness.doc 73.7 kB
  • Word 97-2003/happy-feet-worksheet.doc 200.7 kB
  • Word 97-2003/happy-valentines.doc 47.6 kB
  • Word 97-2003/harriett.doc 2.4 MB
  • Word 97-2003/harriett_001.doc 2.4 MB
  • Word 97-2003/harrods.doc 6.7 MB
  • Word 97-2003/harry-potter-and-the-sorcerer.doc 35.3 kB
  • Word 97-2003/harry-potter.doc 35.8 kB
  • Word 97-2003/has-got.doc 224.8 kB
  • Word 97-2003/have-and-have-got-3-forms.doc 476.2 kB
  • Word 97-2003/have-got-has-got.doc 295.4 kB
  • Word 97-2003/have-got-speaking-cards.doc 3.8 MB
  • Word 97-2003/have-got-to-be.doc 448.5 kB
  • Word 97-2003/have-got.doc 191.5 kB
  • Word 97-2003/have-got_-2-september.doc 335.9 kB
  • Word 97-2003/have-got_001.doc 158.2 kB
  • Word 97-2003/have-got_002.doc 158.2 kB
  • Word 97-2003/have-has-got.doc 474.1 kB
  • Word 97-2003/have-to-dont-have-to.doc 385.0 kB
  • Word 97-2003/have-you-ever.doc 93.7 kB
  • Word 97-2003/have-you-ever_-_.doc 207.4 kB
  • Word 97-2003/have.doc 24.1 kB
  • Word 97-2003/have_001.doc 136.7 kB
  • Word 97-2003/have_or_has_test.doc 29.2 kB
  • Word 97-2003/having_a_bad_day.doc 46.1 kB
  • Word 97-2003/having_a_bad_day_001.doc 46.1 kB
  • Word 97-2003/he-can-play-football-but-he-cant-swim.doc 111.1 kB
  • Word 97-2003/heal-me-warmer.doc 30.2 kB
  • Word 97-2003/heal-the-world.doc 40.4 kB
  • Word 97-2003/health-problems-dealing-with-problems.doc 256.0 kB
  • Word 97-2003/health-problems-multiple-choice.doc 365.6 kB
  • Word 97-2003/health-problems-vocabulary.doc 511.5 kB
  • Word 97-2003/health-problems.doc 129.0 kB
  • Word 97-2003/health-test.doc 40.4 kB
  • Word 97-2003/health-vocabulary.doc 70.7 kB
  • Word 97-2003/health_vocab.doc 469.0 kB
  • Word 97-2003/healthy-unhealthy.doc 519.2 kB
  • Word 97-2003/heidi-1.doc 288.8 kB
  • Word 97-2003/hello-muddah_camp-granada.doc 810.0 kB
  • Word 97-2003/help-libby.doc 416.8 kB
  • Word 97-2003/help-this-little-mouse-find-the-way-to-its-house.doc 137.7 kB
  • Word 97-2003/help.doc 81.4 kB
  • Word 97-2003/helpful-phrases.doc 24.1 kB
  • Word 97-2003/here-comes-the-sun.doc 26.6 kB
  • Word 97-2003/here-with-me-busy-teacher-worksheet.doc 34.3 kB
  • Word 97-2003/hero.doc 44.5 kB
  • Word 97-2003/hero_001.doc 72.7 kB
  • Word 97-2003/hey-jude-imperatives.doc 32.8 kB
  • Word 97-2003/hey-jude1.doc 27.6 kB
  • Word 97-2003/hey-soul-sister-2.doc 120.8 kB
  • Word 97-2003/hey-soul-sister-train.doc 520.7 kB
  • Word 97-2003/hi.doc 36.4 kB
  • Word 97-2003/hide-and-seeek.doc 29.7 kB
  • Word 97-2003/high-numbers-worksheet.doc 552.4 kB
  • Word 97-2003/high-tall.doc 286.2 kB
  • Word 97-2003/highschool-text-and-questions.doc 87.6 kB
  • Word 97-2003/himym-annoying-habits-worksheet.doc 76.3 kB
  • Word 97-2003/history-of-1500.doc 32.8 kB
  • Word 97-2003/history-quiz.doc 29.2 kB
  • Word 97-2003/hobbies-free-time-activities-1.doc 490.5 kB
  • Word 97-2003/hobbies-free-time-activities-2.doc 512.0 kB
  • Word 97-2003/hobbies_cards.doc 39.9 kB
  • Word 97-2003/hocus-pocus.doc 61.4 kB
  • Word 97-2003/hoi-polloi-the-3-stooges.doc 107.5 kB
  • Word 97-2003/holiday.doc 2.2 MB
  • Word 97-2003/holiday_of_my_dreams.doc 70.7 kB
  • Word 97-2003/holiday_of_my_dreams_001.doc 70.7 kB
  • Word 97-2003/holidaypostcard-toclassmate-lepold.doc 30.2 kB
  • Word 97-2003/holidays-box.doc 34.3 kB
  • Word 97-2003/holidays-halloween.doc 1.2 MB
  • Word 97-2003/holidays-para-englishtips.doc 24.6 kB
  • Word 97-2003/holidays-st.doc 184.3 kB
  • Word 97-2003/holidays.doc 38.4 kB
  • Word 97-2003/holidays_001.doc 136.2 kB
  • Word 97-2003/holidays_002.doc 301.1 kB
  • Word 97-2003/home.doc 112.1 kB
  • Word 97-2003/homeville.doc 214.0 kB
  • Word 97-2003/homework-handout.doc 82.9 kB
  • Word 97-2003/homographs.doc 140.8 kB
  • Word 97-2003/homonyms-konacna-verzija-2003.doc 288.3 kB
  • Word 97-2003/homophones-2003.doc 54.3 kB
  • Word 97-2003/homophones-clipart-3.doc 674.8 kB
  • Word 97-2003/homophones-clipart.doc 755.7 kB
  • Word 97-2003/horoscope-personality-traits.doc 238.6 kB
  • Word 97-2003/hot-air-balloon.doc 167.9 kB
  • Word 97-2003/hot-and-cold-by-katty-perry-activities.doc 71.2 kB
  • Word 97-2003/hotel-english.doc 140.8 kB
  • Word 97-2003/hotel-review.doc 201.7 kB
  • Word 97-2003/hotel-transylvania-work-sheet.doc 950.3 kB
  • Word 97-2003/hotel-vocabulary-bingo.doc 127.0 kB
  • Word 97-2003/hound-dog.doc 178.2 kB
  • Word 97-2003/house-and-lost-series-worksheet.doc 277.0 kB
  • Word 97-2003/house-battleship.doc 326.7 kB
  • Word 97-2003/house-board-game.doc 221.7 kB
  • Word 97-2003/house-or-flat.doc 2.0 MB
  • Word 97-2003/house.doc 162.3 kB
  • Word 97-2003/house2.doc 1.3 MB
  • Word 97-2003/household-chores-key.doc 309.8 kB
  • Word 97-2003/household-jobs-crossword.doc 43.5 kB
  • Word 97-2003/household.doc 4.8 MB
  • Word 97-2003/houses.doc 41.5 kB
  • Word 97-2003/how-are-you-feeling-today.doc 278.2 kB
  • Word 97-2003/how-are-you-feeling-today_001.doc 214.0 kB
  • Word 97-2003/how-are-you-happy-sad-2186.doc 203.3 kB
  • Word 97-2003/how-big-is-your-house.doc 260.1 kB
  • Word 97-2003/how-can-i-tell-her_reorder.doc 31.2 kB
  • Word 97-2003/how-do-you-go-to-school.doc 162.3 kB
  • Word 97-2003/how-do-you-read-1.doc 64.5 kB
  • Word 97-2003/how-do-you-read-2.doc 129.5 kB
  • Word 97-2003/how-it.doc 197.1 kB
  • Word 97-2003/how-long-when.doc 29.2 kB
  • Word 97-2003/how-long.doc 52.7 kB
  • Word 97-2003/how-many-words-can-you-write-with-these-letters.doc 221.2 kB
  • Word 97-2003/how-much-geography-do-you-know.doc 203.8 kB
  • Word 97-2003/how-much-how-many-lesson-7b-rice.doc 3.2 MB
  • Word 97-2003/how-much-how-many-lesson-7b-rice_001.doc 2.2 MB
  • Word 97-2003/how-much-how-many-some-any-a-an-class-practice.doc 65.0 kB
  • Word 97-2003/how-much-money.doc 688.6 kB
  • Word 97-2003/how-often-do-you-questions-and-list-of-adverbs.doc 338.4 kB
  • Word 97-2003/how-often-questions.doc 42.0 kB
  • Word 97-2003/how-the-orange-juice-is-made.doc 39.4 kB
  • Word 97-2003/how-the-orange-juice-is-made_001.doc 50.7 kB
  • Word 97-2003/how-the-sun-was-made.doc 50.7 kB
  • Word 97-2003/how-the-sun-was-made_001.doc 51.7 kB
  • Word 97-2003/how-to-pronounce-ed.doc 33.3 kB
  • Word 97-2003/how-to-protect-the-environment.doc 35.3 kB
  • Word 97-2003/how-to-save-a-life.doc 86.5 kB
  • Word 97-2003/how-to-train-your-dragon-lesson-planinternational.doc 115.7 kB
  • Word 97-2003/how-to-write-a-summary.doc 27.1 kB
  • Word 97-2003/how-to-write-an-essay.doc 26.1 kB
  • Word 97-2003/how-we-travel.doc 88.6 kB
  • Word 97-2003/how-well-do-you-know-your-partner.doc 63.0 kB
  • Word 97-2003/how_much_time_do_you_spend_watching_television.doc 47.1 kB
  • Word 97-2003/how_much_time_do_you_spend_watching_television_001.doc 47.1 kB
  • Word 97-2003/how_often.doc 34.8 kB
  • Word 97-2003/hugh-laurie-and-the-am-accent.doc 31.7 kB
  • Word 97-2003/human-bingo-how-i-spent-my-summer.doc 30.7 kB
  • Word 97-2003/human-body-test.doc 57.3 kB
  • Word 97-2003/human-body.doc 63.5 kB
  • Word 97-2003/human_bingo.doc 32.3 kB
  • Word 97-2003/hunger-games-chapter-1.doc 25.1 kB
  • Word 97-2003/hunger-games-video-session.doc 219.1 kB
  • Word 97-2003/hurts.doc 117.8 kB
  • Word 97-2003/hyphenated-modifier.doc 34.3 kB
  • Word 97-2003/i-am-a-native-of-north-america.doc 27.1 kB
  • Word 97-2003/i-can-play-the-guitar.doc 516.6 kB
  • Word 97-2003/i-can-see-clearly-now.doc 146.4 kB
  • Word 97-2003/i-can.doc 115.2 kB
  • Word 97-2003/i-dont-want-to-miss-a-thing-aerosmith.doc 31.7 kB
  • Word 97-2003/i-fough-the-law.doc 27.6 kB
  • Word 97-2003/i-have-a-meeting.doc 35.8 kB
  • Word 97-2003/i-have-done-or-i-did.doc 330.2 kB
  • Word 97-2003/i-like.doc 38.4 kB
  • Word 97-2003/i-love-it.doc 250.4 kB
  • Word 97-2003/i-love-sports.doc 561.7 kB
  • Word 97-2003/i-say-a-little-prayer-for-you_present-simple.doc 88.6 kB
  • Word 97-2003/i-see-the-light.doc 27.1 kB
  • Word 97-2003/i-spent-the-night-in-the.doc 32.8 kB
  • Word 97-2003/i-want-some-flowers.doc 30.7 kB
  • Word 97-2003/i-will-always-love-you-exercise.doc 24.6 kB
  • Word 97-2003/i-will-always-love-you.doc 36.4 kB
  • Word 97-2003/i-will-survive.doc 70.1 kB
  • Word 97-2003/i-wont-give-up_jason_mraz.doc 31.2 kB
  • Word 97-2003/i_feel.doc 162 Bytes
  • Word 97-2003/i_feel_001.doc 162 Bytes
  • Word 97-2003/ibn_sina.doc 160.3 kB
  • Word 97-2003/ibn_sina_001.doc 160.3 kB
  • Word 97-2003/ice-age-3-activity-40.doc 65.5 kB
  • Word 97-2003/ice-age-4-worksheet.doc 266.8 kB
  • Word 97-2003/ice-age-christmas.doc 141.3 kB
  • Word 97-2003/ice-breakers.doc 59.4 kB
  • Word 97-2003/icebreaker-star.doc 30.7 kB
  • Word 97-2003/icebreaker.doc 187.9 kB
  • Word 97-2003/identifying-types-of-clauses_upper-intermediate.doc 20.0 kB
  • Word 97-2003/identity.doc 33.8 kB
  • Word 97-2003/idiom-for-2nd-grade.doc 237.1 kB
  • Word 97-2003/idioms-1.doc 39.9 kB
  • Word 97-2003/idioms-in-speech.doc 217.1 kB
  • Word 97-2003/idioms-of-happiness-and-sadness.doc 30.7 kB
  • Word 97-2003/idioms-of-human-relationships.doc 27.6 kB
  • Word 97-2003/idioms-with-food-ejercicio.doc 32.8 kB
  • Word 97-2003/idioms.doc 49.7 kB
  • Word 97-2003/idiomsquiz.doc 890.4 kB
  • Word 97-2003/idomes-about-good-behaviour-and-politeness.doc 34.8 kB
  • Word 97-2003/if-claus-will.doc 24.6 kB
  • Word 97-2003/if-clauses-mix.doc 37.9 kB
  • Word 97-2003/if-clauses-rephrasing.doc 56.3 kB
  • Word 97-2003/if-clauses.doc 43.0 kB
  • Word 97-2003/if-i-had-eyes.doc 27.6 kB
  • Word 97-2003/if-i-saw-you-in-heaven.doc 31.2 kB
  • Word 97-2003/if-i-were-a-boy-2dn-conditional.doc 34.8 kB
  • Word 97-2003/if-today-was-your-last-day-lyrics-and-activ.doc 84.0 kB
  • Word 97-2003/if-you-could-have-any-job-in-the-world-teacher.doc 32.3 kB
  • Word 97-2003/if-you-had-my-love.doc 45.1 kB
  • Word 97-2003/ill-be-gone.doc 36.4 kB
  • Word 97-2003/ill-be-there-for-you-worksheet-for-the-song.doc 30.7 kB
  • Word 97-2003/ill_b_waiting_lenny.doc 31.2 kB
  • Word 97-2003/im-a-believer.doc 286.7 kB
  • Word 97-2003/im-a-pirate.doc 282.1 kB
  • Word 97-2003/im-blue-eiffel-65-station.doc 293.9 kB
  • Word 97-2003/im-getting-ready-by-michael-kiwanuka-lyrics.doc 256.5 kB
  • Word 97-2003/im-going-to-the-beach.doc 190.0 kB
  • Word 97-2003/im-not-calling-you-a-liar.doc 446.0 kB
  • Word 97-2003/im-only-me-when-im-with-you-act.doc 236.0 kB
  • Word 97-2003/im-with-you-avril-new-edition.doc 109.6 kB
  • Word 97-2003/im-yours.doc 39.4 kB
  • Word 97-2003/imagine.doc 34.3 kB
  • Word 97-2003/imagine_001.doc 54.8 kB
  • Word 97-2003/immediate-future-needs.doc 295.4 kB
  • Word 97-2003/imperative-classroom-instructions.doc 183.8 kB
  • Word 97-2003/imperative.doc 347.6 kB
  • Word 97-2003/imperative_001.doc 106.5 kB
  • Word 97-2003/imperative_002.doc 307.7 kB
  • Word 97-2003/in-at-to.doc 27.1 kB
  • Word 97-2003/in-summer.doc 168.4 kB
  • Word 97-2003/in-the-city.doc 24.6 kB
  • Word 97-2003/in-the-kitchen-deco.doc 290.3 kB
  • Word 97-2003/in-the-kitchen.doc 198.7 kB
  • Word 97-2003/in-the-kitchen_001.doc 162.3 kB
  • Word 97-2003/in-the-office.doc 183.3 kB
  • Word 97-2003/in-the-shadowsworksheet-.doc 30.7 kB
  • Word 97-2003/in-your-hands2.doc 36.9 kB
  • Word 97-2003/inception.doc 115.2 kB
  • Word 97-2003/incomplete-song.doc 172.5 kB
  • Word 97-2003/indefinite-pronouns-_somebody-anybody_etc.doc 371.7 kB
  • Word 97-2003/indefinite-pronouns.doc 125.4 kB
  • Word 97-2003/indefinite-pronouns_001.doc 367.6 kB
  • Word 97-2003/indefinite-pronouns_002.doc 510.5 kB
  • Word 97-2003/indefinte-pronouns-2012.doc 223.2 kB
  • Word 97-2003/indirect_speech_theory.doc 52.7 kB
  • Word 97-2003/ineed.doc 29.2 kB
  • Word 97-2003/infinitive-and-gerund.doc 120.3 kB
  • Word 97-2003/infinitive-or-gerund-practice.doc 50.2 kB
  • Word 97-2003/infinitive-or-gerund.doc 33.8 kB
  • Word 97-2003/infinitive-or-gerund_001.doc 47.6 kB
  • Word 97-2003/infinitive-without-to.doc 51.7 kB
  • Word 97-2003/infinitive.doc 210.4 kB
  • Word 97-2003/infinitivesong.doc 662.0 kB
  • Word 97-2003/ing_ger_.doc 94.2 kB
  • Word 97-2003/inky.doc 115.7 kB
  • Word 97-2003/innoccence-trabalhada.doc 76.3 kB
  • Word 97-2003/insects-board-game.doc 3.4 MB
  • Word 97-2003/insects.doc 278.5 kB
  • Word 97-2003/insert-the-correct-form-of-the-verb-in-brackets.doc 199.2 kB
  • Word 97-2003/insert-the-correct-question.doc 30.2 kB
  • Word 97-2003/int2-have-you-ever.doc 32.8 kB
  • Word 97-2003/int2-have-you-ever_001.doc 33.8 kB
  • Word 97-2003/interm-practice-work.doc 377.9 kB
  • Word 97-2003/intermediate-tenses-1.doc 125.4 kB
  • Word 97-2003/intermediate-tenses-1_001.doc 125.4 kB
  • Word 97-2003/intermediate-tenses-2.doc 80.4 kB
  • Word 97-2003/intermediate-tenses-2_001.doc 80.4 kB
  • Word 97-2003/intermediate-tenses-2_002.doc 80.4 kB
  • Word 97-2003/international-food.doc 198.1 kB
  • Word 97-2003/internet.doc 62.5 kB
  • Word 97-2003/Internet_dangers_for_children_and_teenagers_reading_.doc 22.0 kB
  • Word 97-2003/interrogation-past-continuous-roleplay.doc 12.3 kB
  • Word 97-2003/interupper-inter-shopping.doc 325.1 kB
  • Word 97-2003/interview-with-javier-bardem.doc 24.6 kB
  • Word 97-2003/inthemood.doc 119.3 kB
  • Word 97-2003/intro-b-unit-14-simple-past-adele.doc 943.6 kB
  • Word 97-2003/intro-to-eng-conditionals.doc 88.1 kB
  • Word 97-2003/introducing-yourself-neighbour-pair-work.doc 85.5 kB
  • Word 97-2003/introducing.doc 509.4 kB
  • Word 97-2003/introduction-to-unit-42.doc 801.8 kB
  • Word 97-2003/inventions.doc 30.7 kB
  • Word 97-2003/inventions_001.doc 432.6 kB
  • Word 97-2003/invitation-card.doc 1.8 MB
  • Word 97-2003/invitation.doc 25.6 kB
  • Word 97-2003/iotm_intermediate_3_unit_4_making-excuses_dfff.doc 148.5 kB
  • Word 97-2003/irish-sayings.doc 24.1 kB
  • Word 97-2003/irr-verbs-bookmark.doc 62.5 kB
  • Word 97-2003/irreg-verbs-simple-past.doc 269.8 kB
  • Word 97-2003/irregualr-verbs.doc 77.8 kB
  • Word 97-2003/irregular-english-verbs-with-pictures.doc 965.1 kB
  • Word 97-2003/irregular-flash-1.doc 508.4 kB
  • Word 97-2003/irregular-plural.doc 29.2 kB
  • Word 97-2003/irregular-verb-test.doc 63.5 kB
  • Word 97-2003/irregular-verb-test_001.doc 39.4 kB
  • Word 97-2003/irregular-verbs-2.doc 25.6 kB
  • Word 97-2003/irregular-verbs-cards.doc 282.5 kB
  • Word 97-2003/irregular-verbs-exercises.doc 30.2 kB
  • Word 97-2003/irregular-verbs-game.doc 63.5 kB
  • Word 97-2003/irregular-verbs-simple-past.doc 14.8 kB
  • Word 97-2003/irregular-verbs.doc 44.5 kB
  • Word 97-2003/irregular.doc 193.5 kB
  • Word 97-2003/irregular1.doc 205.8 kB
  • Word 97-2003/irregular_001.doc 71.7 kB
  • Word 97-2003/Irregular_Verb_Pres._Perf.doc 29.2 kB
  • Word 97-2003/irregulars.doc 161.8 kB
  • Word 97-2003/irregulars_001.doc 157.7 kB
  • Word 97-2003/irrg-v.doc 196.6 kB
  • Word 97-2003/is-there-anything-to-eat-worksheet.doc 71.2 kB
  • Word 97-2003/is-this-the-most-dangerous-restaurant-in-the-world.doc 491.0 kB
  • Word 97-2003/is-this-the-most-dangerous-restaurant-in-the-world_001.doc 491.5 kB
  • Word 97-2003/is-this-yours.doc 78.8 kB
  • Word 97-2003/island-in-the-sunworksheet-.doc 61.4 kB
  • Word 97-2003/islcollective_adverbs_of_frequency_180514db07533bf.doc 98.3 kB
  • Word 97-2003/ispolzovanie-have-got.doc 91.1 kB
  • Word 97-2003/it-belongs-to-me.doc 32.3 kB
  • Word 97-2003/it-is-christmas-time_activities.doc 626.7 kB
  • Word 97-2003/it-or-there-advanced.doc 71.7 kB
  • Word 97-2003/it_workshop_slowniczek.doc 75.3 kB
  • Word 97-2003/ithaka.doc 41.0 kB
  • Word 97-2003/its-halloween-lo-ween.doc 219.1 kB
  • Word 97-2003/iv-for-busy.doc 859.1 kB
  • Word 97-2003/ive-got-a-blue-skirt.doc 267.3 kB
  • Word 97-2003/ive-got-my-own-room.doc 242.7 kB
  • Word 97-2003/ivegot.doc 39.4 kB
  • Word 97-2003/jack-o-lantern.doc 261.1 kB
  • Word 97-2003/jack-o-lantern_001.doc 420.4 kB
  • Word 97-2003/jack_and_the_beanstalk.doc 332.3 kB
  • Word 97-2003/jack_and_the_beanstalk_001.doc 332.3 kB
  • Word 97-2003/jack_johnson_3rs.doc 37.4 kB
  • Word 97-2003/january-holidays.doc 1.5 MB
  • Word 97-2003/january.doc 212.0 kB
  • Word 97-2003/japan-wksh.doc 332.3 kB
  • Word 97-2003/jeff-buckley.doc 81.9 kB
  • Word 97-2003/jennifer-aniston.doc 47.6 kB
  • Word 97-2003/jennifer-aniston_001.doc 188.4 kB
  • Word 97-2003/jeremy-clarkson-and-the-smallest-car-in-the-world.doc 27.1 kB
  • Word 97-2003/jessie-j-gap-fill.doc 27.6 kB
  • Word 97-2003/jewellery-and-accessories.doc 283.1 kB
  • Word 97-2003/jewellery-and-accessories_001.doc 283.1 kB
  • Word 97-2003/jewellery-and-accessories_002.doc 287.2 kB
  • Word 97-2003/jingle-bell-rock.doc 318.0 kB
  • Word 97-2003/jingle-bells.doc 35.8 kB
  • Word 97-2003/job-domino.doc 1.0 MB
  • Word 97-2003/job-interview-roleplay.doc 38.9 kB
  • Word 97-2003/job.doc 29.7 kB
  • Word 97-2003/job_001.doc 1.7 MB
  • Word 97-2003/jobs-1.doc 210.9 kB
  • Word 97-2003/jobs-2.doc 201.2 kB
  • Word 97-2003/jobs-2_001.doc 230.4 kB
  • Word 97-2003/jobs-and-numbers.doc 28.2 kB
  • Word 97-2003/jobs-and-occupations.doc 2.8 MB
  • Word 97-2003/jobs-decoding.doc 218.6 kB
  • Word 97-2003/jobs-esl.doc 372.7 kB
  • Word 97-2003/jobs-inter.doc 536.6 kB
  • Word 97-2003/jobs-listening-pre-intermediate.doc 153.1 kB
  • Word 97-2003/jobs-masako.doc 210.9 kB
  • Word 97-2003/jobs-queue.doc 49.2 kB
  • Word 97-2003/jobs-queue_001.doc 43.5 kB
  • Word 97-2003/jobs-wordsearch-key.doc 502.8 kB
  • Word 97-2003/jobs.doc 35.3 kB
  • Word 97-2003/jobs2.doc 2.9 MB
  • Word 97-2003/jobs2_001.doc 655.4 kB
  • Word 97-2003/jobs3.doc 660.5 kB
  • Word 97-2003/jobs_001.doc 387.1 kB
  • Word 97-2003/jobs_002.doc 500.2 kB
  • Word 97-2003/jobs_003.doc 56.3 kB
  • Word 97-2003/jobs_crossword.doc 205.8 kB
  • Word 97-2003/jobs_crossword_001.doc 205.8 kB
  • Word 97-2003/jobs_crossword_002.doc 5.5 MB
  • Word 97-2003/jobs_match.doc 73.2 kB
  • Word 97-2003/john-lennon-imagine.doc 72.2 kB
  • Word 97-2003/john-was-playing-basketball-when-i-saw-him.doc 118.3 kB
  • Word 97-2003/john-was-playing-basketball-when-i-saw-him_001.doc 118.8 kB
  • Word 97-2003/johnnys-birthday.doc 84.0 kB
  • Word 97-2003/johnnys-birthday_001.doc 508.4 kB
  • Word 97-2003/johnnys-birthday_002.doc 84.0 kB
  • Word 97-2003/join-the-lines.doc 37.9 kB
  • Word 97-2003/jokes.doc 52.2 kB
  • Word 97-2003/jokes_1.doc 43.0 kB
  • Word 97-2003/jokes_1_001.doc 43.0 kB
  • Word 97-2003/jon-lajoie-listening.doc 260.6 kB
  • Word 97-2003/joseph-worksheet.doc 33.3 kB
  • Word 97-2003/joshua-rotine.doc 217.1 kB
  • Word 97-2003/joshua-rotine_001.doc 217.1 kB
  • Word 97-2003/joshua-rotine_1_.doc 217.1 kB
  • Word 97-2003/joshua-rotine_1__001.doc 215.0 kB
  • Word 97-2003/jungle-sea.doc 235.0 kB
  • Word 97-2003/juniorcuc4iceage.doc 149.0 kB
  • Word 97-2003/juniorcuc4iceage_001.doc 146.9 kB
  • Word 97-2003/just-for-fun-marriage.doc 29.2 kB
  • Word 97-2003/just-rephrasing-key.doc 134.7 kB
  • Word 97-2003/just-the-way-you-are.doc 33.3 kB
  • Word 97-2003/just_the_way_you_are.doc 43.5 kB
  • Word 97-2003/justin-bieber.doc 38.4 kB
  • Word 97-2003/k-pax-movie-worksheet.doc 165.4 kB
  • Word 97-2003/kartochki-dlya-doski-grammar-fight.doc 44.0 kB
  • Word 97-2003/kate-middleton.doc 257.5 kB
  • Word 97-2003/katy-perry-firework-lp.doc 37.9 kB
  • Word 97-2003/katy-perry-hot-and-cold-to-fill.doc 44.5 kB
  • Word 97-2003/katy_perry_last-friday-night.doc 2.8 MB
  • Word 97-2003/ken-wilbard-pesnya-sing-the-song.doc 154.6 kB
  • Word 97-2003/killing-fields.doc 42.5 kB
  • Word 97-2003/kings-of-convenience.doc 44.5 kB
  • Word 97-2003/kitchen-action.doc 584.2 kB
  • Word 97-2003/kitchen-decoding.doc 299.5 kB
  • Word 97-2003/kitchen.doc 254.0 kB
  • Word 97-2003/kitchen_001.doc 130.0 kB
  • Word 97-2003/kitchen_002.doc 294.4 kB
  • Word 97-2003/kitchen_003.doc 174.1 kB
  • Word 97-2003/knock-knock-song.doc 302.1 kB
  • Word 97-2003/koala.doc 68.6 kB
  • Word 97-2003/komnata.doc 415.2 kB
  • Word 97-2003/kopiya-kopiya-well-you-done-done-me-and-you-bet-i.doc 26.6 kB
  • Word 97-2003/kpax-worksheet.doc 38.9 kB
  • Word 97-2003/L4_I_will_always_love_you.doc 94.7 kB
  • Word 97-2003/la-isla-bonita-lyrics.doc 46.1 kB
  • Word 97-2003/labrinth-beneath-your-beautiful.doc 51.2 kB
  • Word 97-2003/lady-gaga.doc 259.1 kB
  • Word 97-2003/lady.doc 89.6 kB
  • Word 97-2003/language-quiz1.doc 40.4 kB
  • Word 97-2003/language-twisters-pentru-scoala.doc 34.8 kB
  • Word 97-2003/languages_english_quiz.doc 1.5 MB
  • Word 97-2003/languages_english_quiz_001.doc 1.5 MB
  • Word 97-2003/languages_problem_h.doc 41.5 kB
  • Word 97-2003/languages_problem_h_001.doc 41.5 kB
  • Word 97-2003/las-2.doc 40.4 kB
  • Word 97-2003/last-christmas.doc 102.4 kB
  • Word 97-2003/last-christmas_001.doc 34.3 kB
  • Word 97-2003/last-christmas_002.doc 58.9 kB
  • Word 97-2003/last-christmas_003.doc 114.2 kB
  • Word 97-2003/last-christmas_004.doc 1.2 MB
  • Word 97-2003/last-weekend.doc 109.6 kB
  • Word 97-2003/last-xmas.doc 28.2 kB
  • Word 97-2003/last.doc 1.9 MB
  • Word 97-2003/lauras-flat.doc 58.4 kB
  • Word 97-2003/lazy-bones.doc 137.2 kB
  • Word 97-2003/learning-l2.doc 52.2 kB
  • Word 97-2003/learning-revolution.doc 1.0 MB
  • Word 97-2003/leisure-time-activities-survey-1-mail.doc 149.0 kB
  • Word 97-2003/lemon-tree-activity.doc 67.1 kB
  • Word 97-2003/lemon-tree.doc 21.5 kB
  • Word 97-2003/lemon-tree_001.doc 714.8 kB
  • Word 97-2003/lenka-without-words.doc 485.9 kB
  • Word 97-2003/leona-lewis-to-complete.doc 28.7 kB
  • Word 97-2003/leprechauns.doc 38.4 kB
  • Word 97-2003/lesson-1.doc 50.2 kB
  • Word 97-2003/lesson-2-daily-routines.doc 935.4 kB
  • Word 97-2003/lesson-2-daily-routines_001.doc 942.1 kB
  • Word 97-2003/lesson-5-bac-unit-1-upload.doc 494.6 kB
  • Word 97-2003/lesson-7.doc 107.5 kB
  • Word 97-2003/lesson-plan-1.doc 235.5 kB
  • Word 97-2003/lesson-plan-10.doc 44.5 kB
  • Word 97-2003/lesson-plan-_-fix-you.doc 38.4 kB
  • Word 97-2003/lesson-plan-experiment-group.doc 74.8 kB
  • Word 97-2003/lesson-plan-framework.doc 404.5 kB
  • Word 97-2003/let-it-snow.doc 27.1 kB
  • Word 97-2003/let-us-move-on-worksheet.doc 760.3 kB
  • Word 97-2003/leta-talk-abot-e-mail.doc 254.5 kB
  • Word 97-2003/lets-read-about-bmi.doc 308.7 kB
  • Word 97-2003/lets-read-and-write-about.doc 324.6 kB
  • Word 97-2003/lets-read-and-write-about_001.doc 344.1 kB
  • Word 97-2003/lets-read-and-write-about_002.doc 295.9 kB
  • Word 97-2003/lets-read-and-write-about_003.doc 267.3 kB
  • Word 97-2003/lets-read-and-write-about_004.doc 539.1 kB
  • Word 97-2003/lets-read-and-write-about_005.doc 423.9 kB
  • Word 97-2003/lets-read-and-write-about_006.doc 425.5 kB
  • Word 97-2003/lets-read-and-write-about_007.doc 295.9 kB
  • Word 97-2003/lets-read-and-write-about_008.doc 292.4 kB
  • Word 97-2003/lets-read.doc 129.5 kB
  • Word 97-2003/lets-talk-about-negotiations.doc 829.4 kB
  • Word 97-2003/lets-talk-about-sleeping.doc 27.1 kB
  • Word 97-2003/lets-talk1.doc 230.9 kB
  • Word 97-2003/lets-talk1_001.doc 233.5 kB
  • Word 97-2003/letscook.doc 128.5 kB
  • Word 97-2003/letter-captain-w-persuasion.doc 12.8 kB
  • Word 97-2003/letter-of-complaint-exp.doc 26.1 kB
  • Word 97-2003/letter.doc 316.9 kB
  • Word 97-2003/letters-specific-language.doc 256.0 kB
  • Word 97-2003/level-1-lesson-10-colours2.doc 1.3 MB
  • Word 97-2003/level-1-lesson-11-img.doc 2.8 MB
  • Word 97-2003/level-1-unit-3-day-2-worksheet.doc 27.1 kB
  • Word 97-2003/level-2-what-do-you-want-to-do.doc 42.5 kB
  • Word 97-2003/lg-2-ho-1.doc 283.1 kB
  • Word 97-2003/life-after-love_sherr_song.doc 43.0 kB
  • Word 97-2003/like-dislike.doc 126.0 kB
  • Word 97-2003/like.doc 52.7 kB
  • Word 97-2003/like_001.doc 1.1 MB
  • Word 97-2003/likes-and-dislikes.doc 53.2 kB
  • Word 97-2003/likes-and-dislikes_001.doc 4.1 MB
  • Word 97-2003/likes-and-dislikes_002.doc 273.9 kB
  • Word 97-2003/likes-dislikes-practice.doc 445.4 kB
  • Word 97-2003/likes-dislikes.doc 305.2 kB
  • Word 97-2003/likes-dislikes2.doc 81.4 kB
  • Word 97-2003/lilo-and-stitch-movie-worksheet.doc 38.4 kB
  • Word 97-2003/linkers-and-connectors.doc 43.0 kB
  • Word 97-2003/linkin-park-leave-out-all-the-rest.doc 55.3 kB
  • Word 97-2003/linking-2012.doc 251.9 kB
  • Word 97-2003/linking-ideas.doc 50.7 kB
  • Word 97-2003/linking-park.doc 24.1 kB
  • Word 97-2003/linking-words-2013.doc 91.1 kB
  • Word 97-2003/linking-words-agosto-2012.doc 1.0 MB
  • Word 97-2003/linking-words-of-reason-practice.doc 38.9 kB
  • Word 97-2003/linking-words-practice-key.doc 37.4 kB
  • Word 97-2003/linking-words-rephrasing.doc 109.6 kB
  • Word 97-2003/linking-words.doc 101.9 kB
  • Word 97-2003/linking-words_001.doc 135.2 kB
  • Word 97-2003/list-act-obs.doc 23.0 kB
  • Word 97-2003/list-of-irregular-and-regular-verbs.doc 47.1 kB
  • Word 97-2003/listen-and-circle.doc 23.6 kB
  • Word 97-2003/listen-to-the-song-and-fill-in-the-gaps.doc 30.7 kB
  • Word 97-2003/listen-to-your-heart-song-worksheet.doc 23.0 kB
  • Word 97-2003/listening-activity-im-with-you.doc 318.0 kB
  • Word 97-2003/listening-activity-yell-out-dialogue.doc 34.8 kB
  • Word 97-2003/listening-adol-pre-int.doc 31.2 kB
  • Word 97-2003/listening-carly-rea-jepsen-call-me-maybe.doc 56.8 kB
  • Word 97-2003/listening-hollywood-marina-and-the-diamonds.doc 32.3 kB
  • Word 97-2003/listening-jessie-ware-wildest-moments.doc 40.4 kB
  • Word 97-2003/listening-juniors-three.doc 28.7 kB
  • Word 97-2003/listening-oceana-put-your-gun-down.doc 59.9 kB
  • Word 97-2003/listening-the-art-of-good-complaining.doc 35.8 kB
  • Word 97-2003/listening.doc 41.5 kB
  • Word 97-2003/little-talks-worksheet.doc 28.2 kB
  • Word 97-2003/little-things-one-direction.doc 106.0 kB
  • Word 97-2003/little.doc 22.0 kB
  • Word 97-2003/live-forever.doc 30.2 kB
  • Word 97-2003/living-room.doc 137.7 kB
  • Word 97-2003/living-room_001.doc 116.7 kB
  • Word 97-2003/living-without-gravity.doc 33.8 kB
  • Word 97-2003/london.doc 349.2 kB
  • Word 97-2003/London_001.doc 348.2 kB
  • Word 97-2003/London_002.doc 349.7 kB
  • Word 97-2003/long-black-veil.doc 27.6 kB
  • Word 97-2003/long-live-taylor-swift.doc 434.7 kB
  • Word 97-2003/look-and-trace.doc 104.4 kB
  • Word 97-2003/look-at-the-picture-and-fill-in-the-gaps-with-the.doc 213.0 kB
  • Word 97-2003/look-at-the-pictures.doc 96.3 kB
  • Word 97-2003/lopez-if-you-had-my-love.doc 87.6 kB
  • Word 97-2003/lost-2nd.doc 29.7 kB
  • Word 97-2003/louis-armstrong_what-a-won-world_handout.doc 143.4 kB
  • Word 97-2003/louis-armstrong_what-a-won-world_plurals.doc 75.8 kB
  • Word 97-2003/love-and-relationships-speaking-cards.doc 118.3 kB
  • Word 97-2003/love-in-its-many-forms.doc 89.6 kB
  • Word 97-2003/love-potion-no.doc 137.2 kB
  • Word 97-2003/love-the-way-you-lie-eminem-rihanna.doc 77.8 kB
  • Word 97-2003/love.doc 199.2 kB
  • Word 97-2003/love_001.doc 52.2 kB
  • Word 97-2003/loving-you.doc 18.9 kB
  • Word 97-2003/lucky-octopus.doc 42.0 kB
  • Word 97-2003/lucky.doc 13.8 kB
  • Word 97-2003/lucy-doesn.doc 29.2 kB
  • Word 97-2003/lulus-simple-past-tense.doc 65.5 kB
  • Word 97-2003/luxurious-lexis.doc 24.6 kB
  • Word 97-2003/lyrics-flame-relay-olympics-2012-answers.doc 66.0 kB
  • Word 97-2003/lyrics-flame-relay-olympics-2012.doc 65.5 kB
  • Word 97-2003/lyrics-othello-rap.doc 24.1 kB
  • Word 97-2003/lyrics.doc 224.3 kB
  • Word 97-2003/lyricsjeff-buckley-hallelujah.doc 37.9 kB
  • Word 97-2003/machu-picchu.doc 57.3 kB
  • Word 97-2003/madagascar-3-worksheet.doc 440.3 kB
  • Word 97-2003/madagascar-ii-set-of-activities-children.doc 242.2 kB
  • Word 97-2003/madagascar-worksheet.doc 100.9 kB
  • Word 97-2003/madagaskar-characters.doc 572.9 kB
  • Word 97-2003/madonna-masterpiece.doc 1.0 MB
  • Word 97-2003/madonna-nothing-really-matters.doc 10.8 kB
  • Word 97-2003/magic-e.doc 351.2 kB
  • Word 97-2003/magic-word.doc 125.4 kB
  • Word 97-2003/make-do-exerci.doc 166.9 kB
  • Word 97-2003/make-do-give-get.doc 38.4 kB
  • Word 97-2003/make-do-have.doc 34.8 kB
  • Word 97-2003/make-or-do-board-game.doc 165.4 kB
  • Word 97-2003/make-or-do-board-game_001.doc 160.3 kB
  • Word 97-2003/make-or-do-collocations-key.doc 369.7 kB
  • Word 97-2003/make-or-do.doc 109.1 kB
  • Word 97-2003/make-the-question.doc 180.7 kB
  • Word 97-2003/make-the-sentences-negative.doc 25.6 kB
  • Word 97-2003/make-up-a-story-fairy-tales.doc 261.6 kB
  • Word 97-2003/making-comparisons.doc 136.7 kB
  • Word 97-2003/making-continuous-forms-of-verbs.doc 37.4 kB
  • Word 97-2003/making-questions.doc 36.4 kB
  • Word 97-2003/making-questions_001.doc 33.8 kB
  • Word 97-2003/making-story.doc 78.3 kB
  • Word 97-2003/making-suggestions-and-expressing-preferences.doc 25.1 kB
  • Word 97-2003/making-suggestions-and-expressing-preferences_.doc 29.2 kB
  • Word 97-2003/making-the-words.doc 163.3 kB
  • Word 97-2003/mama-mia.doc 32.3 kB
  • Word 97-2003/mama.doc 160.8 kB
  • Word 97-2003/mamma-mia.doc 32.8 kB
  • Word 97-2003/mandela-invictus-worksheet.doc 26.6 kB
  • Word 97-2003/manners-story-with-cards.doc 33.3 kB
  • Word 97-2003/many_much_few_little.doc 48.1 kB
  • Word 97-2003/many_much_few_little_001.doc 48.1 kB
  • Word 97-2003/map.doc 217.6 kB
  • Word 97-2003/marias.doc 1.1 MB
  • Word 97-2003/mary-max-exercises-on-the-animation.doc 29.7 kB
  • Word 97-2003/mary-max-script-18-33.doc 40.4 kB
  • Word 97-2003/mass-media-reading.doc 327.7 kB
  • Word 97-2003/mass-media-report.doc 37.4 kB
  • Word 97-2003/masterpiece-by-madonna.doc 275.5 kB
  • Word 97-2003/masters-cp-nounpronoun-quiz.doc 39.9 kB
  • Word 97-2003/match-the-food-with-the-country.doc 2.7 MB
  • Word 97-2003/match-the-parts.doc 32.3 kB
  • Word 97-2003/match-the-picture-in-this-table-to-the-country.doc 2.2 MB
  • Word 97-2003/material-an225lise.doc 964.6 kB
  • Word 97-2003/matilda-handout.doc 340.5 kB
  • Word 97-2003/maxwell.doc 37.4 kB
  • Word 97-2003/may-might-must-be-able.doc 22.0 kB
  • Word 97-2003/may-might.doc 326.1 kB
  • Word 97-2003/means-of-transport-land.doc 276.0 kB
  • Word 97-2003/means-of-transport-new.doc 508.4 kB
  • Word 97-2003/means-of-transport.doc 212.0 kB
  • Word 97-2003/means-of-transport_001.doc 285.2 kB
  • Word 97-2003/medieval-life.doc 108.5 kB
  • Word 97-2003/meet-sandra-weird.doc 25.6 kB
  • Word 97-2003/melanie-fiona.doc 376.3 kB
  • Word 97-2003/memory-animals.doc 180.7 kB
  • Word 97-2003/memory-game-past-participle.doc 37.4 kB
  • Word 97-2003/memory-game.doc 770.6 kB
  • Word 97-2003/memy-interestsmy-family.doc 25.1 kB
  • Word 97-2003/menas-of-transport-sea.doc 191.5 kB
  • Word 97-2003/mens-wear.doc 118.3 kB
  • Word 97-2003/mens-wera-pict.doc 547.8 kB
  • Word 97-2003/menwithhatsriddlestory.doc 67.1 kB
  • Word 97-2003/merlin-season-1-episode-2-w.doc 308.7 kB
  • Word 97-2003/messi.doc 265.2 kB
  • Word 97-2003/metaphors.doc 29.7 kB
  • Word 97-2003/mice-dialogo.doc 151.6 kB
  • Word 97-2003/mice-dialogo_001.doc 163.3 kB
  • Word 97-2003/michael-bubl233-on-the-graham-norton-show-script.doc 39.4 kB
  • Word 97-2003/michael-jackson-hold-my-hand-duet-with-akon-ft.doc 247.8 kB
  • Word 97-2003/michael-jackson.doc 28.7 kB
  • Word 97-2003/michael-jacksons-thriller.doc 26.1 kB
  • Word 97-2003/microsoft-excel-basic-mac.doc 62.0 kB
  • Word 97-2003/microsoft-excel.doc 66.0 kB
  • Word 97-2003/microsoft-word-review.doc 136.7 kB
  • Word 97-2003/mid-year-test-2009.doc 184.8 kB
  • Word 97-2003/might-exercises.doc 214.0 kB
  • Word 97-2003/might.doc 290.8 kB
  • Word 97-2003/Might_Exercises.doc 220.2 kB
  • Word 97-2003/Might_Exercises_001.doc 220.2 kB
  • Word 97-2003/milkman.doc 44.0 kB
  • Word 97-2003/milkman_001.doc 44.0 kB
  • Word 97-2003/mingle.doc 114.7 kB
  • Word 97-2003/miscellaneous-exam.doc 47.6 kB
  • Word 97-2003/miscellanous-test-first-term.doc 39.4 kB
  • Word 97-2003/mistletoe-and-wine.doc 27.6 kB
  • Word 97-2003/mixed-active-passive-voice.doc 28.7 kB
  • Word 97-2003/mixed-conditional-clauses.doc 135.7 kB
  • Word 97-2003/mixed-food.doc 492.5 kB
  • Word 97-2003/mixed-letters_find-the-domestic-animal.doc 67.1 kB
  • Word 97-2003/mixed-prepositions.doc 126.0 kB
  • Word 97-2003/mixed-rephrasing-2-active-direct-speech-key.doc 82.9 kB
  • Word 97-2003/mixed-reprhasing-1-passive-reported-key.doc 82.9 kB
  • Word 97-2003/mixed-tense-revision-present-tense.doc 35.3 kB
  • Word 97-2003/mixed-tenses-test.doc 37.9 kB
  • Word 97-2003/mixed-tenses.doc 48.6 kB
  • Word 97-2003/mixed-tenses_001.doc 37.4 kB
  • Word 97-2003/mixed-tenses_002.doc 37.4 kB
  • Word 97-2003/mixed-tenses_003.doc 37.4 kB
  • Word 97-2003/mlk2.doc 239.6 kB
  • Word 97-2003/mny-house.doc 1.1 MB
  • Word 97-2003/modal-and-semi.doc 33.3 kB
  • Word 97-2003/modal-verbs-2013.doc 53.8 kB
  • Word 97-2003/modal-verbs-ability.doc 287.7 kB
  • Word 97-2003/modal-verbs-dec2012.doc 234.5 kB
  • Word 97-2003/modal-verbs-intermediate-ii.doc 184.8 kB
  • Word 97-2003/modal-verbs-key.doc 117.2 kB
  • Word 97-2003/modal-verbs-shall-or-will.doc 628.7 kB
  • Word 97-2003/modal-verbs-study-sheet-homework.doc 94.2 kB
  • Word 97-2003/modal-verbs-worksheets.doc 77.3 kB
  • Word 97-2003/modal-verbs.doc 39.4 kB
  • Word 97-2003/modal-verbs_001.doc 38.4 kB
  • Word 97-2003/modal-verbs_002.doc 109.1 kB
  • Word 97-2003/modal-verbs_003.doc 109.6 kB
  • Word 97-2003/modal.doc 2.3 MB
  • Word 97-2003/modal_001.doc 231.9 kB
  • Word 97-2003/modal_verbs.doc 29.2 kB
  • Word 97-2003/modal_verbs_001.doc 29.2 kB
  • Word 97-2003/modal_verbs_1.doc 579.1 kB
  • Word 97-2003/modal_verbs_1_001.doc 579.1 kB
  • Word 97-2003/modal_verbs_1_002.doc 579.1 kB
  • Word 97-2003/modal_verbs_1_003.doc 579.1 kB
  • Word 97-2003/Modal_Verbs_Ability.doc 285.7 kB
  • Word 97-2003/modals-advice-opinions-degrees-of-certainty.doc 271.4 kB
  • Word 97-2003/modals-of-obligation-strange-laws.doc 26.6 kB
  • Word 97-2003/modals-test.doc 42.5 kB
  • Word 97-2003/modals-trafic-signs.doc 208.4 kB
  • Word 97-2003/modals-verb-test.doc 50.7 kB
  • Word 97-2003/modals.doc 95.2 kB
  • Word 97-2003/modals_001.doc 95.2 kB
  • Word 97-2003/modals_002.doc 37.9 kB
  • Word 97-2003/modals_003.doc 156.7 kB
  • Word 97-2003/modals_cards_lang_2012.doc 30.2 kB
  • Word 97-2003/moj-anglijskij.doc 2.4 MB
  • Word 97-2003/money.doc 21.0 kB
  • Word 97-2003/monika_szalwinska_pytania_i_odpowiedzi.doc 121.9 kB
  • Word 97-2003/mononoke_film_activity.doc 780.3 kB
  • Word 97-2003/monster_high_kids.doc 375.8 kB
  • Word 97-2003/monster_high_kidsplus.doc 544.3 kB
  • Word 97-2003/monsterriddles.doc 99.8 kB
  • Word 97-2003/monsters-inc-adjective-worksheet-beginner-and.doc 195.1 kB
  • Word 97-2003/monsters-inc-descriptions-and-worksheet.doc 2.9 MB
  • Word 97-2003/monsters-inc.doc 171.5 kB
  • Word 97-2003/months-dates-ordinals-cardinals.doc 511.0 kB
  • Word 97-2003/months-of-the-year.doc 186.9 kB
  • Word 97-2003/months-of-the-year_001.doc 258.6 kB
  • Word 97-2003/moods.doc 626.7 kB
  • Word 97-2003/moon-landing-you-tube-activity.doc 102.4 kB
  • Word 97-2003/moonshadow-cat-stevens-exercises-song-first.doc 2.3 MB
  • Word 97-2003/more-serious-health-problems.doc 347.6 kB
  • Word 97-2003/more-word-formation.doc 98.3 kB
  • Word 97-2003/more-word-formation_001.doc 95.2 kB
  • Word 97-2003/most-poisonous-2.doc 878.6 kB
  • Word 97-2003/mother-match.doc 201.2 kB
  • Word 97-2003/mothers-professions.doc 169.0 kB
  • Word 97-2003/moves-like-a-jagger.doc 44.0 kB
  • Word 97-2003/moves-like-jagger.doc 96.8 kB
  • Word 97-2003/moves-like-jagger_001.doc 33.8 kB
  • Word 97-2003/moves-like-jagger_002.doc 92.2 kB
  • Word 97-2003/movie-class-toy-story-3.doc 641.5 kB
  • Word 97-2003/movie-time-jurassic-park-part-2.doc 204.3 kB
  • Word 97-2003/movie-time-jurassic-park.doc 264.7 kB
  • Word 97-2003/mr-bean-act.doc 43.0 kB
  • Word 97-2003/mr-bean-act_001.doc 41.0 kB
  • Word 97-2003/mr-bean-goes-to-a-judo-class-video-activity.doc 214.5 kB
  • Word 97-2003/mr.doc 130.6 kB
  • Word 97-2003/mrs-ramsey.doc 27.6 kB
  • Word 97-2003/mtv-cribs.doc 500.2 kB
  • Word 97-2003/muallems.doc 43.5 kB
  • Word 97-2003/multimediaactivity-frenchkissmovie.doc 39.9 kB
  • Word 97-2003/music-activitie-adelesomeone-like-you.doc 193.5 kB
  • Word 97-2003/music-talk.doc 32.3 kB
  • Word 97-2003/music-worksheet_queen_bohemian-rhapsody.doc 25.6 kB
  • Word 97-2003/music1.doc 156.2 kB
  • Word 97-2003/music_soundofsanfrancisco.doc 52.7 kB
  • Word 97-2003/must-and-have-to.doc 41.0 kB
  • Word 97-2003/must-and-mustnt.doc 667.1 kB
  • Word 97-2003/must-can.doc 125.4 kB
  • Word 97-2003/must-school-rules.doc 44.5 kB
  • Word 97-2003/must.doc 239.6 kB
  • Word 97-2003/must_001.doc 151.0 kB
  • Word 97-2003/must_002.doc 95.7 kB
  • Word 97-2003/my-best-friend-kyle.doc 24.1 kB
  • Word 97-2003/my-cousin-is-from-new-york-and-his-name.doc 24.1 kB
  • Word 97-2003/my-eslprintables-2.doc 419.8 kB
  • Word 97-2003/my-family.doc 49.2 kB
  • Word 97-2003/my-family_001.doc 382.5 kB
  • Word 97-2003/my-favourite-toys.doc 479.2 kB
  • Word 97-2003/my-happy-ending.doc 47.1 kB
  • Word 97-2003/my-leisure-time.doc 38.4 kB
  • Word 97-2003/my-life-as-a-hermit_newspaper-article.doc 70.7 kB
  • Word 97-2003/my-movie-is-oral-prep-sheet.doc 86.5 kB
  • Word 97-2003/my-own-planet.doc 23.6 kB
  • Word 97-2003/my-pet.doc 36.9 kB
  • Word 97-2003/my-question-sheeg.doc 39.4 kB
  • Word 97-2003/my-robot.doc 42.0 kB
  • Word 97-2003/my-summer-composition.doc 452.1 kB
  • Word 97-2003/my-way_lyrics.doc 67.6 kB
  • Word 97-2003/my_body_activities.doc 197.1 kB
  • Word 97-2003/my_fav_mont_worksheet.doc 160.3 kB
  • Word 97-2003/name_as_many1....doc 22.5 kB
  • Word 97-2003/name_listening-shapes.doc 466.9 kB
  • Word 97-2003/narrative-by-me.doc 32.3 kB
  • Word 97-2003/naryan_rubric_-career.doc 30.7 kB
  • Word 97-2003/nasredin.doc 23.0 kB
  • Word 97-2003/nastolnaya-igra-conditionals-1.doc 36.4 kB
  • Word 97-2003/nationalities.doc 50.2 kB
  • Word 97-2003/nationalities_001.doc 537.1 kB
  • Word 97-2003/nationalities_002.doc 63.5 kB
  • Word 97-2003/nationality-domino.doc 128.5 kB
  • Word 97-2003/natural-disasters.doc 79.9 kB
  • Word 97-2003/natural.doc 176.1 kB
  • Word 97-2003/nature.doc 182.8 kB
  • Word 97-2003/needs-analysis-form.doc 44.5 kB
  • Word 97-2003/needs-assessment-1.doc 1.2 MB
  • Word 97-2003/negative.doc 45.1 kB
  • Word 97-2003/neighbors-role-play.doc 28.7 kB
  • Word 97-2003/neighbors-role-playA.doc 14 Bytes
  • Word 97-2003/neil.doc 32.8 kB
  • Word 97-2003/neil_001.doc 32.8 kB
  • Word 97-2003/nessie.doc 263.7 kB
  • Word 97-2003/new-crimes.doc 35.3 kB
  • Word 97-2003/new-microsoft-word-document.doc 24.1 kB
  • Word 97-2003/new-year-around-the-world.doc 112.1 kB
  • Word 97-2003/new-years-resolutions.doc 107.0 kB
  • Word 97-2003/news_strange.doc 35.3 kB
  • Word 97-2003/news_strange_001.doc 35.3 kB
  • Word 97-2003/nickelback-lyrics-with-activities.doc 160.8 kB
  • Word 97-2003/nickleback_photograph.doc 57.3 kB
  • Word 97-2003/nicks-favorite-day.doc 53.8 kB
  • Word 97-2003/nightat-the-museum2-worksh.doc 2.7 MB
  • Word 97-2003/no-sunshin.doc 401.9 kB
  • Word 97-2003/noisy-toys.doc 60.9 kB
  • Word 97-2003/none-of-us-are-free.doc 56.3 kB
  • Word 97-2003/nothing-but-sports.doc 282.1 kB
  • Word 97-2003/noun-formation-suffix.doc 91.1 kB
  • Word 97-2003/noun-forming-syffixes.doc 176.1 kB
  • Word 97-2003/noun-test.doc 25.1 kB
  • Word 97-2003/nounpreposition.doc 124.9 kB
  • Word 97-2003/nouns-1.doc 127.5 kB
  • Word 97-2003/nouns-game.doc 41.5 kB
  • Word 97-2003/novaya-tablica-glagolov.doc 252.4 kB
  • Word 97-2003/novye-slova-modul3.doc 44.5 kB
  • Word 97-2003/now-you-can-practice-solids-and-plane-shapes.doc 50.2 kB
  • Word 97-2003/nujood-ali-1-2008-los-angeles-times.doc 139.8 kB
  • Word 97-2003/nujood-ali-2-after-the-divorce.doc 64.5 kB
  • Word 97-2003/numb-by-linkin-park-prepositions.doc 45.1 kB
  • Word 97-2003/number-word-search.doc 26.6 kB
  • Word 97-2003/numbers-1-10-chant.doc 29.2 kB
  • Word 97-2003/numbers-1-10.doc 234.0 kB
  • Word 97-2003/numbers-1-15.doc 460.8 kB
  • Word 97-2003/numbers-1-5.doc 548.4 kB
  • Word 97-2003/numbers-in-english-questions-elementary.doc 430.6 kB
  • Word 97-2003/numbers-skolka.doc 64.5 kB
  • Word 97-2003/numbers-subjects.doc 28.2 kB
  • Word 97-2003/numbers-worksheet.doc 191.5 kB
  • Word 97-2003/numbers.doc 26.1 kB
  • Word 97-2003/numbers10-20.doc 27.1 kB
  • Word 97-2003/numbers2.doc 24.1 kB
  • Word 97-2003/numbers_001.doc 453.6 kB
  • Word 97-2003/numbers_002.doc 268.8 kB
  • Word 97-2003/numbers_003.doc 187.4 kB
  • Word 97-2003/numbers_004.doc 174.1 kB
  • Word 97-2003/numbers_005.doc 119.8 kB
  • Word 97-2003/numbers_006.doc 22.0 kB
  • Word 97-2003/numbers_5.doc 95.7 kB
  • Word 97-2003/ny-resolutions-3.doc 198.1 kB
  • Word 97-2003/obama-in-latin-america.doc 93.7 kB
  • Word 97-2003/obama-school-speech_gapped_task1.doc 64.0 kB
  • Word 97-2003/obamas-victory-speech.doc 138.2 kB
  • Word 97-2003/objects3.doc 190.0 kB
  • Word 97-2003/occupations1.doc 1.2 MB
  • Word 97-2003/occupations2.doc 511.5 kB
  • Word 97-2003/occupations2_001.doc 919.6 kB
  • Word 97-2003/Odessa_holiday.doc 26.1 kB
  • Word 97-2003/og243lne.doc 42.5 kB
  • Word 97-2003/ok-i-get-it.doc 34.8 kB
  • Word 97-2003/olympic-country-profiles-worksheet.doc 327.7 kB
  • Word 97-2003/olympics-song-proud.doc 262.1 kB
  • Word 97-2003/on-a-day-like-today-wkst.doc 72.7 kB
  • Word 97-2003/on-sunday-it-was-my-birthday.doc 54.8 kB
  • Word 97-2003/on-tap-he-7-len-8.doc 173.6 kB
  • Word 97-2003/on-the-move.doc 279.6 kB
  • Word 97-2003/on_a_winters_day_-_i_put_on_my_coat_hat_etc.doc 295.0 kB
  • Word 97-2003/once-upon-a-time-i.doc 53.8 kB
  • Word 97-2003/once-were-warriors.doc 203.8 kB
  • Word 97-2003/one-5-copy.doc 107.0 kB
  • Word 97-2003/one-of-the-difficulties-of-the-english-language.doc 38.4 kB
  • Word 97-2003/one-ones.doc 465.4 kB
  • Word 97-2003/one-ones_001.doc 198.7 kB
  • Word 97-2003/one-republic-all-fall-down.doc 154.1 kB
  • Word 97-2003/one-republic-marching-on.doc 240.6 kB
  • Word 97-2003/one-republic-secrets.doc 420.9 kB
  • Word 97-2003/one-thing-one-direction.doc 32.3 kB
  • Word 97-2003/one-year-of-love-handout.doc 26.1 kB
  • Word 97-2003/oneminutetalk.doc 34.3 kB
  • Word 97-2003/online-one.doc 2.9 MB
  • Word 97-2003/only-you1.doc 42.2 kB
  • Word 97-2003/onomatopoeia.doc 44.0 kB
  • Word 97-2003/opposite-words-test.doc 35.8 kB
  • Word 97-2003/opposites-1.doc 1.7 MB
  • Word 97-2003/opposites.doc 251.9 kB
  • Word 97-2003/oral-comprehension-about-gmos.doc 30.2 kB
  • Word 97-2003/oral-practice-simple-past.doc 25.6 kB
  • Word 97-2003/oral-presentation-rubric.doc 47.6 kB
  • Word 97-2003/orchestra-test.doc 352.8 kB
  • Word 97-2003/order-of-adjectives.doc 128.0 kB
  • Word 97-2003/order-of-the-adjectives.doc 74.2 kB
  • Word 97-2003/ordinal-numbers.doc 194.6 kB
  • Word 97-2003/ordinal-numbers_001.doc 48.1 kB
  • Word 97-2003/ordinal-numbers_002.doc 178.7 kB
  • Word 97-2003/other-3.doc 224.3 kB
  • Word 97-2003/our-body.doc 292.4 kB
  • Word 97-2003/our-family-in-the-country.doc 388.1 kB
  • Word 97-2003/our-family.doc 148.5 kB
  • Word 97-2003/our-friendly-family.doc 128.5 kB
  • Word 97-2003/our-living-room.doc 107.0 kB
  • Word 97-2003/our-living-room_001.doc 98.8 kB
  • Word 97-2003/our-pastime-poem.doc 31.2 kB
  • Word 97-2003/outline-for-a-five-paragraph-essay.doc 41.0 kB
  • Word 97-2003/outline-for-a-five-paragraph-essay_001.doc 41.0 kB
  • Word 97-2003/outside-my-house.doc 190.0 kB
  • Word 97-2003/over-the-hedge-activity2.doc 137.2 kB
  • Word 97-2003/over-the-rainbow-by-connie-talbot-fill-in-ws.doc 9.8 MB
  • Word 97-2003/over_the-_rainbow.doc 23.0 kB
  • Word 97-2003/overview-of-conditionals.doc 74.8 kB
  • Word 97-2003/overview-of-passive.doc 100.4 kB
  • Word 97-2003/owl-city-fireflies.doc 213.0 kB
  • Word 97-2003/p-d-ws-3.doc 151.6 kB
  • Word 97-2003/p1u2bfirst-date.doc 42.5 kB
  • Word 97-2003/paint-my-love.doc 770.6 kB
  • Word 97-2003/painting-activities.doc 183.8 kB
  • Word 97-2003/painting-pictures-with-words.doc 22.5 kB
  • Word 97-2003/pairwork.doc 30.7 kB
  • Word 97-2003/pairwork_001.doc 238.1 kB
  • Word 97-2003/palindromes.doc 280.6 kB
  • Word 97-2003/paradise-coldplaly.doc 31.2 kB
  • Word 97-2003/paradise-coldplay.doc 106.1 kB
  • Word 97-2003/paramore-the-only-exception-was_were.doc 457.2 kB
  • Word 97-2003/parkour.doc 391.7 kB
  • Word 97-2003/part-time-jobs-test.doc 130.6 kB
  • Word 97-2003/part-v-my-own-production.doc 128.5 kB
  • Word 97-2003/partly-cloudy-worksheet.doc 327.2 kB
  • Word 97-2003/parts-of-the-body-sizzlin.doc 59.4 kB
  • Word 97-2003/parts-of-the-body.doc 35.3 kB
  • Word 97-2003/parts-of-the-body1.doc 37.4 kB
  • Word 97-2003/parts-of-the-body_001.doc 152.1 kB
  • Word 97-2003/pas-simple-in-class.doc 43.0 kB
  • Word 97-2003/pasados-t-d-id.doc 131.1 kB
  • Word 97-2003/pasapalabra.doc 77.3 kB
  • Word 97-2003/pasapalabra_001.doc 77.8 kB
  • Word 97-2003/pass-the-parcel-load-of-words.doc 24.1 kB
  • Word 97-2003/passive-did-you-know-pre-int.doc 1.7 MB
  • Word 97-2003/passive-to-active.doc 29.2 kB
  • Word 97-2003/passive-voice-2.doc 36.9 kB
  • Word 97-2003/passive-voice-ana.doc 166.9 kB
  • Word 97-2003/passive-voice-exercises-english.doc 33.8 kB
  • Word 97-2003/passive-voice-intermediate.doc 116.2 kB
  • Word 97-2003/passive-voice-practice.doc 282.6 kB
  • Word 97-2003/passive-voice.doc 27.6 kB
  • Word 97-2003/passive-voice_001.doc 25.6 kB
  • Word 97-2003/passive-voice_002.doc 34.8 kB
  • Word 97-2003/passive-voice_003.doc 277.5 kB
  • Word 97-2003/passive-voicepresent-continuous.doc 200.7 kB
  • Word 97-2003/passive-with-past-simple.doc 97.8 kB
  • Word 97-2003/passive.doc 215.0 kB
  • Word 97-2003/passive_present.doc 79.9 kB
  • Word 97-2003/passive_report.doc 33.8 kB
  • Word 97-2003/passive_voice_drill.doc 40.4 kB
  • Word 97-2003/passive_voice_drill_001.doc 40.4 kB
  • Word 97-2003/passive_voice_practice.doc 30.7 kB
  • Word 97-2003/passive_voice_practice_001.doc 30.7 kB
  • Word 97-2003/passiveactiveform.doc 100.9 kB
  • Word 97-2003/passiveactiveform_001.doc 100.9 kB
  • Word 97-2003/past-continuous-2013.doc 66.0 kB
  • Word 97-2003/past-continuous-adverbs.doc 299.5 kB
  • Word 97-2003/past-continuous-tense.doc 23.0 kB
  • Word 97-2003/past-continuous.doc 113.7 kB
  • Word 97-2003/past-continuous_001.doc 157.2 kB
  • Word 97-2003/past-continuous_002.doc 157.2 kB
  • Word 97-2003/past-continuous_003.doc 246.3 kB
  • Word 97-2003/past-continuous_004.doc 139.8 kB
  • Word 97-2003/past-events.doc 246.8 kB
  • Word 97-2003/past-modals_degrees-of-certainty.doc 55.3 kB
  • Word 97-2003/past-modals_should-neednt-have.doc 55.8 kB
  • Word 97-2003/past-perfect-form.doc 38.9 kB
  • Word 97-2003/past-perfect-speaking-activity.doc 233.5 kB
  • Word 97-2003/past-perfect-tense-past-perfect-continuous-3.doc 40.4 kB
  • Word 97-2003/past-perfect-tenses.doc 21.0 kB
  • Word 97-2003/past-perfect.doc 34.8 kB
  • Word 97-2003/past-perfect_001.doc 123.9 kB
  • Word 97-2003/past-perfect_002.doc 36.9 kB
  • Word 97-2003/past-s-and-c-ex-ces.doc 65.5 kB
  • Word 97-2003/past-simple-12.doc 165.9 kB
  • Word 97-2003/past-simple-2001-2.doc 338.9 kB
  • Word 97-2003/past-simple-2001-2_001.doc 337.4 kB
  • Word 97-2003/past-simple-2011.doc 416.3 kB
  • Word 97-2003/past-simple-7c.doc 79.4 kB
  • Word 97-2003/past-simple-all-forms.doc 31.2 kB
  • Word 97-2003/past-simple-and-continuous.doc 149.0 kB
  • Word 97-2003/past-simple-and-continuous_-ana.doc 160.3 kB
  • Word 97-2003/past-simple-and-past-c_lesson.doc 49.2 kB
  • Word 97-2003/past-simple-and-past-continuous.doc 105.0 kB
  • Word 97-2003/past-simple-and-past-continuous_001.doc 50.7 kB
  • Word 97-2003/past-simple-and-past-perfect-key.doc 213.5 kB
  • Word 97-2003/past-simple-busy-teacher.doc 134.7 kB
  • Word 97-2003/past-simple-exercises.doc 25.1 kB
  • Word 97-2003/past-simple-form-of-verb-to-be.doc 32.8 kB
  • Word 97-2003/past-simple-game.doc 156.2 kB
  • Word 97-2003/past-simple-irreg.doc 134.1 kB
  • Word 97-2003/past-simple-irregular-2012.doc 119.3 kB
  • Word 97-2003/past-simple-irregular-verbs.doc 154.1 kB
  • Word 97-2003/past-simple-irregular-verbs_001.doc 228.4 kB
  • Word 97-2003/past-simple-irregular.doc 154.1 kB
  • Word 97-2003/past-simple-irregular_001.doc 156.2 kB
  • Word 97-2003/past-simple-irregular_002.doc 156.2 kB
  • Word 97-2003/past-simple-key.doc 140.8 kB
  • Word 97-2003/past-simple-listening-katy-perry-pre-intermediate.doc 48.1 kB
  • Word 97-2003/past-simple-mixed-regular-irregular-verbs.doc 174.6 kB
  • Word 97-2003/past-simple-or-continuous-key.doc 528.4 kB
  • Word 97-2003/past-simple-or-past-continuous-key.doc 213.0 kB
  • Word 97-2003/past-simple-or-past-perfect.doc 41.5 kB
  • Word 97-2003/past-simple-or-past-perfect_001.doc 32.3 kB
  • Word 97-2003/past-simple-or-present-perfect.doc 34.3 kB
  • Word 97-2003/past-simple-or-present-perfect_001.doc 42.5 kB
  • Word 97-2003/past-simple-perfect-present-perfect.doc 147.5 kB
  • Word 97-2003/past-simple-present-perfect-2011.doc 115.7 kB
  • Word 97-2003/past-simple-present-perfect-gap-filling-key.doc 511.0 kB
  • Word 97-2003/past-simple-regular-2012.doc 137.2 kB
  • Word 97-2003/past-simple-regular-verbs.doc 94.2 kB
  • Word 97-2003/past-simple-regular-verbs_001.doc 119.3 kB
  • Word 97-2003/past-simple-regular-verbs_002.doc 115.7 kB
  • Word 97-2003/past-simple-regular.doc 228.9 kB
  • Word 97-2003/past-simple-set.doc 214.5 kB
  • Word 97-2003/past-simple-song-activity-nancy-sinatra-bang-bang.doc 49.7 kB
  • Word 97-2003/past-simple-speaking-cards-_set-1.doc 28.2 kB
  • Word 97-2003/past-simple-speaking-cards-_set-2.doc 28.7 kB
  • Word 97-2003/past-simple-speaking-cards-_set-3.doc 28.7 kB
  • Word 97-2003/past-simple-test.doc 31.2 kB
  • Word 97-2003/past-simple-test_001.doc 110.1 kB
  • Word 97-2003/past-simple-to-be-dec2012.doc 1.2 MB
  • Word 97-2003/past-simple-to-be-regular-verbs.doc 206.3 kB
  • Word 97-2003/past-simple-to-be-was-were.doc 304.1 kB
  • Word 97-2003/past-simple-to-be.doc 143.4 kB
  • Word 97-2003/past-simple-until-the-end-of-the-world.doc 24.1 kB
  • Word 97-2003/past-simple-vs-past-continuous-2013.doc 87.6 kB
  • Word 97-2003/past-simple-vs-past-continuous.doc 35.3 kB
  • Word 97-2003/past-simple-vs-past-continuous_001.doc 120.8 kB
  • Word 97-2003/past-simple-vs-past-continuous_002.doc 37.4 kB
  • Word 97-2003/past-simple-vs-past-continuous_003.doc 136.2 kB
  • Word 97-2003/past-simple-vs-present-perfect-and-past-perfect.doc 408.1 kB
  • Word 97-2003/past-simple-worksheet.doc 43.0 kB
  • Word 97-2003/past-simple.doc 31.2 kB
  • Word 97-2003/past-simple_001.doc 27.6 kB
  • Word 97-2003/past-simple_002.doc 47.6 kB
  • Word 97-2003/past-simple_003.doc 49.7 kB
  • Word 97-2003/past-simple_004.doc 803.8 kB
  • Word 97-2003/past-simple_005.doc 2.0 MB
  • Word 97-2003/past-simplepast-continous-and-past-perfect.doc 70.7 kB
  • Word 97-2003/past-sipmle-games.doc 919.0 kB
  • Word 97-2003/past-tense-chart-speaking-activity.doc 71.2 kB
  • Word 97-2003/past-tense-practice.doc 31.2 kB
  • Word 97-2003/past-tensesmine.doc 144.4 kB
  • Word 97-2003/past.doc 62.5 kB
  • Word 97-2003/past_continuous.doc 245.8 kB
  • Word 97-2003/Past_Perfect_Simple_charades.doc 31.2 kB
  • Word 97-2003/pastcontinuous2.doc 353.8 kB
  • Word 97-2003/patch-adams_project-2012.doc 25.6 kB
  • Word 97-2003/pau-gasol.doc 167.9 kB
  • Word 97-2003/pay-it-forward-questions-and-vocab-0000-4000.doc 411.1 kB
  • Word 97-2003/payphone.doc 32.8 kB
  • Word 97-2003/penelope-cruz-on-david-letterman-sp.doc 24.1 kB
  • Word 97-2003/peoples-daily-routine.doc 434.2 kB
  • Word 97-2003/perfect-or-past.doc 48.6 kB
  • Word 97-2003/perfect-tense-review_with-resume.doc 37.4 kB
  • Word 97-2003/personal-information-worksheet.doc 52.2 kB
  • Word 97-2003/personal-information.doc 416.3 kB
  • Word 97-2003/personal-information_worksheet.doc 42.0 kB
  • Word 97-2003/personal-opinions.doc 49.2 kB
  • Word 97-2003/personal-pronouns-01.doc 160.8 kB
  • Word 97-2003/personal-pronouns-3ero.doc 68.1 kB
  • Word 97-2003/personal-pronouns-and-nationalities.doc 89.6 kB
  • Word 97-2003/personal-pronouns-and-possessive-adjectives.doc 99.3 kB
  • Word 97-2003/personal-pronouns-object.doc 100.9 kB
  • Word 97-2003/personal-pronouns-subject.doc 321.5 kB
  • Word 97-2003/personal-pronouns.doc 149.5 kB
  • Word 97-2003/personal-pronouns_001.doc 188.9 kB
  • Word 97-2003/personal-pronouns_002.doc 180.2 kB
  • Word 97-2003/personal-qualities.doc 26.6 kB
  • Word 97-2003/personality-adjectives-2012-intermediate.doc 743.9 kB
  • Word 97-2003/personality-appearance-pair-work-activity.doc 199.2 kB
  • Word 97-2003/personality-revision-ki-astrology.doc 32.8 kB
  • Word 97-2003/personality_test.doc 42.0 kB
  • Word 97-2003/personality_test_001.doc 42.0 kB
  • Word 97-2003/peter-gabriel-michael-jackson.doc 31.2 kB
  • Word 97-2003/pets.doc 161.3 kB
  • Word 97-2003/phil-collins-son-of-man.doc 22.5 kB
  • Word 97-2003/phonemic-groups.doc 25.1 kB
  • Word 97-2003/phonetics-ight.doc 24.1 kB
  • Word 97-2003/phonetics-oo.doc 24.6 kB
  • Word 97-2003/phonetics-worksheet-1.doc 52.2 kB
  • Word 97-2003/phonetique.doc 145.4 kB
  • Word 97-2003/phonetique2.doc 152.6 kB
  • Word 97-2003/phonetique2_001.doc 152.6 kB
  • Word 97-2003/phonetique_001.doc 145.4 kB
  • Word 97-2003/phrasal-verb-pyramid.doc 268.3 kB
  • Word 97-2003/phrasal-verb-with-make.doc 378.4 kB
  • Word 97-2003/phrasal-verbs-1.doc 58.4 kB
  • Word 97-2003/phrasal-verbs-1_001.doc 182.3 kB
  • Word 97-2003/phrasal-verbs-daily-routines.doc 167.9 kB
  • Word 97-2003/phrasal-verbs-exercises-with-answers.doc 55.3 kB
  • Word 97-2003/phrasal-verbs-lisa.doc 66.0 kB
  • Word 97-2003/phrasal-verbs-succes-in-fce-1.doc 50.7 kB
  • Word 97-2003/phrasal-verbs-travel.doc 23.0 kB
  • Word 97-2003/phrasal-verbs-with-for-and-on.doc 286.0 kB
  • Word 97-2003/phrasal-verbs-with-in-cards.doc 273.9 kB
  • Word 97-2003/phrasal-verbs-with-in.doc 186.4 kB
  • Word 97-2003/phrasal-verbs-with-look.doc 380.9 kB
  • Word 97-2003/phrasal-verbs-with-off-and-up.doc 304.1 kB
  • Word 97-2003/phrasal-verbs-with-off.doc 181.2 kB
  • Word 97-2003/phrasal-verbs-with-on.doc 224.8 kB
  • Word 97-2003/phrasal-verbs-with-out-flash-cards.doc 230.9 kB
  • Word 97-2003/phrasal-verbs-with-out.doc 233.5 kB
  • Word 97-2003/phrasal-verbs-with-take.doc 198.1 kB
  • Word 97-2003/phrasal-verbs-with-up.doc 285.7 kB
  • Word 97-2003/phrasal-verbs.doc 34.3 kB
  • Word 97-2003/phrasal-verbs_001.doc 33.8 kB
  • Word 97-2003/phrasal-verbs_002.doc 147.5 kB
  • Word 97-2003/phrasal-verbs_003.doc 217.1 kB
  • Word 97-2003/phrasal-verbs_004.doc 181.8 kB
  • Word 97-2003/phrasals-make-and-do.doc 1.4 MB
  • Word 97-2003/phrases-with-get.doc 35.3 kB
  • Word 97-2003/phrases-with-get_001.doc 17.9 kB
  • Word 97-2003/physical-description.doc 126.0 kB
  • Word 97-2003/physical-description_001.doc 49.2 kB
  • Word 97-2003/physical.doc 182.8 kB
  • Word 97-2003/pi2-how-long-have-you.doc 32.8 kB
  • Word 97-2003/picnic.doc 67.1 kB
  • Word 97-2003/picture-preet-co.doc 479.2 kB
  • Word 97-2003/pies.doc 33.8 kB
  • Word 97-2003/pink-raise-your-hand.doc 342.5 kB
  • Word 97-2003/place.doc 162.8 kB
  • Word 97-2003/place_prepositions_practice.doc 47.1 kB
  • Word 97-2003/place_prepositions_practice_001.doc 47.1 kB
  • Word 97-2003/placement-test.doc 95.7 kB
  • Word 97-2003/places-directions.doc 60.4 kB
  • Word 97-2003/places-in-the-city-nationalities.doc 927.7 kB
  • Word 97-2003/planet-earth-in-danger.doc 222.2 kB
  • Word 97-2003/plans-for-future.doc 1.1 MB
  • Word 97-2003/plastic-surgery.doc 22.0 kB
  • Word 97-2003/platypus.doc 20.5 kB
  • Word 97-2003/please-and-thank-you-song.doc 52.2 kB
  • Word 97-2003/plral-of-nouns-2012.doc 471.6 kB
  • Word 97-2003/plural-12.doc 308.7 kB
  • Word 97-2003/plural-of-nouns.doc 249.3 kB
  • Word 97-2003/plurals-demonstratives.doc 930.3 kB
  • Word 97-2003/plurals.doc 299.0 kB
  • Word 97-2003/poem.doc 60.4 kB
  • Word 97-2003/poem_in_a_picture.doc 33.8 kB
  • Word 97-2003/poem_in_a_picture_001.doc 33.8 kB
  • Word 97-2003/poli.doc 36.9 kB
  • Word 97-2003/politeness-doesnt-pay.doc 501.2 kB
  • Word 97-2003/political-nightmares.doc 13.8 kB
  • Word 97-2003/poor-ahmet.doc 28.2 kB
  • Word 97-2003/pop-psychology-quizz.doc 108.5 kB
  • Word 97-2003/pop-quiz-5-harry-and-frenk.doc 30.7 kB
  • Word 97-2003/population-countries.doc 514.0 kB
  • Word 97-2003/poryadok-slov-v-predlozhenii-2003.doc 608.8 kB
  • Word 97-2003/posneg-words-fairy-tales-bingo.doc 10.2 MB
  • Word 97-2003/poss-pronouns-and-adjs-int.doc 34.3 kB
  • Word 97-2003/possesive-adjectives.doc 23.6 kB
  • Word 97-2003/possessive-adjectives-2012.doc 162.8 kB
  • Word 97-2003/possessive-adjectives-sheet.doc 421.8 kB
  • Word 97-2003/possessive-adjectives.doc 576.0 kB
  • Word 97-2003/possessive-case.doc 150.0 kB
  • Word 97-2003/possessive-determiners.doc 421.4 kB
  • Word 97-2003/possessive-pronoun-organizer.doc 31.7 kB
  • Word 97-2003/possessive-pronouns.doc 117.8 kB
  • Word 97-2003/possessive-pronouns_001.doc 24.6 kB
  • Word 97-2003/possessive-pronouns_002.doc 25.6 kB
  • Word 97-2003/possessive_bt_correct.doc 28.7 kB
  • Word 97-2003/possessive_case_04__worksheet.doc 228.4 kB
  • Word 97-2003/possessive_case_04__worksheet_001.doc 228.4 kB
  • Word 97-2003/possessive_pronouns_1.doc 32.8 kB
  • Word 97-2003/possessives.doc 109.1 kB
  • Word 97-2003/possessives1.doc 41.0 kB
  • Word 97-2003/possessives1_001.doc 41.0 kB
  • Word 97-2003/possessives_001.doc 942.6 kB
  • Word 97-2003/postcard.doc 56.8 kB
  • Word 97-2003/postoffice-test.doc 702.5 kB
  • Word 97-2003/postofice.doc 570.4 kB
  • Word 97-2003/potato-chips.doc 165.4 kB
  • Word 97-2003/potc-trailer.doc 37.4 kB
  • Word 97-2003/pr.doc 45.6 kB
  • Word 97-2003/practica-2-ex-2-tri.doc 213.0 kB
  • Word 97-2003/practical-work-past-tense.doc 63.5 kB
  • Word 97-2003/practical_task_shallow_grou.doc 57.3 kB
  • Word 97-2003/practical_task_the_day_afte.doc 67.1 kB
  • Word 97-2003/practice-korrep-1.doc 37.9 kB
  • Word 97-2003/practice-p.doc 161.8 kB
  • Word 97-2003/PRACTICE_COMPARATIVES_A.doc 45.1 kB
  • Word 97-2003/practico-n1865-tercer-grupo.doc 2.4 MB
  • Word 97-2003/practise-on-adjectives.doc 73.2 kB
  • Word 97-2003/pray-by-justin-bieber.doc 31.7 kB
  • Word 97-2003/pray-by-justin-bieberwsh.doc 31.7 kB
  • Word 97-2003/pre-entry-phonology-2.doc 28.2 kB
  • Word 97-2003/pre-entry-phonology-7.doc 27.6 kB
  • Word 97-2003/pre-entry-sentences.doc 43.5 kB
  • Word 97-2003/pre-sim.doc 234.0 kB
  • Word 97-2003/pre.doc 24.1 kB
  • Word 97-2003/prefer-rather.doc 319.5 kB
  • Word 97-2003/prefer.doc 266.8 kB
  • Word 97-2003/prefixes-worksheet.doc 53.2 kB
  • Word 97-2003/prefixes.doc 122.4 kB
  • Word 97-2003/prefixes_001.doc 91.6 kB
  • Word 97-2003/preinter-shopping.doc 99.3 kB
  • Word 97-2003/prep-of-place-1.doc 497.7 kB
  • Word 97-2003/prep-of-place.doc 169.5 kB
  • Word 97-2003/prep.doc 67.1 kB
  • Word 97-2003/prepositiions-of-time-t.doc 259.6 kB
  • Word 97-2003/preposition-of-movement.doc 131.6 kB
  • Word 97-2003/prepositional-verbs-10th-form.doc 197.1 kB
  • Word 97-2003/prepositions-exercise.doc 39.4 kB
  • Word 97-2003/prepositions-following-adjectives.doc 262.1 kB
  • Word 97-2003/prepositions-july2012.doc 445.4 kB
  • Word 97-2003/prepositions-of-movement.doc 153.1 kB
  • Word 97-2003/prepositions-of-place.doc 102.9 kB
  • Word 97-2003/prepositions-of-place_001.doc 92.7 kB
  • Word 97-2003/prepositions-of-place_002.doc 643.6 kB
  • Word 97-2003/prepositions-of-time-1.doc 183.3 kB
  • Word 97-2003/prepositions-of-time-2012.doc 115.2 kB
  • Word 97-2003/prepositions-of-time-22.doc 331.3 kB
  • Word 97-2003/prepositions-of-time-at-on-in.doc 34.8 kB
  • Word 97-2003/prepositions-of-time-place-and-movement.doc 185.9 kB
  • Word 97-2003/prepositions-of-time-place-and-movement_001.doc 131.1 kB
  • Word 97-2003/prepositions-of-time.doc 349.2 kB
  • Word 97-2003/prepositions-practice.doc 414.7 kB
  • Word 97-2003/prepositions-with-verbs.doc 103.9 kB
  • Word 97-2003/prepositions.doc 241.7 kB
  • Word 97-2003/prepositions_001.doc 43.0 kB
  • Word 97-2003/prepositions_002.doc 135.7 kB
  • Word 97-2003/prepositions_003.doc 72.2 kB
  • Word 97-2003/prepositions_004.doc 102.9 kB
  • Word 97-2003/prepositions_005.doc 55.8 kB
  • Word 97-2003/prepositions_006.doc 257.5 kB
  • Word 97-2003/prepositions_007.doc 329.7 kB
  • Word 97-2003/prepositions_008.doc 60.9 kB
  • Word 97-2003/prepositions_009.doc 53.2 kB
  • Word 97-2003/prepositions_010.doc 58.9 kB
  • Word 97-2003/prepositions_1_.doc 68.1 kB
  • Word 97-2003/prepositions_3-sep.doc 129.0 kB
  • Word 97-2003/prepositions_3-sep_001.doc 129.0 kB
  • Word 97-2003/prepositions__nouns.doc 81.4 kB
  • Word 97-2003/prepositions__nouns_001.doc 81.4 kB
  • Word 97-2003/prepositions_ioni.doc 1.0 MB
  • Word 97-2003/prepositions_ioni_001.doc 1.0 MB
  • Word 97-2003/Prepositions_of_place.doc 107.5 kB
  • Word 97-2003/pres-cont-arrangements.doc 35.8 kB
  • Word 97-2003/pres-cont-vs-simple.doc 26.6 kB
  • Word 97-2003/pres-simple-11.doc 369.2 kB
  • Word 97-2003/pres-simple-2.doc 503.8 kB
  • Word 97-2003/pres_perf_quiz.doc 15.4 kB
  • Word 97-2003/present-and-continuous.doc 31.2 kB
  • Word 97-2003/present-and-past-habits.doc 29.2 kB
  • Word 97-2003/present-cont-tense_color.doc 6.1 MB
  • Word 97-2003/present-continous-2012.doc 499.7 kB
  • Word 97-2003/present-continuous-2011.doc 243.2 kB
  • Word 97-2003/present-continuous-for-description.doc 136.7 kB
  • Word 97-2003/present-continuous-future-arrangements.doc 267.3 kB
  • Word 97-2003/present-continuous-homework.doc 205.8 kB
  • Word 97-2003/present-continuous-iii.doc 161.3 kB
  • Word 97-2003/present-continuous-key.doc 142.3 kB
  • Word 97-2003/present-continuous-or-present-simple.doc 29.2 kB
  • Word 97-2003/present-continuous-part-i.doc 390.1 kB
  • Word 97-2003/present-continuous-practice.doc 837.1 kB
  • Word 97-2003/present-continuous-present-simple.doc 149.0 kB
  • Word 97-2003/present-continuous-present-simple_001.doc 156.2 kB
  • Word 97-2003/present-continuous-sep-2011.doc 244.2 kB
  • Word 97-2003/present-continuous-simpsons.doc 144.4 kB
  • Word 97-2003/present-continuous-test.doc 112.1 kB
  • Word 97-2003/present-continuous-test_001.doc 331.3 kB
  • Word 97-2003/present-continuous-worksheet.doc 737.3 kB
  • Word 97-2003/present-continuous-worksheets.doc 86.0 kB
  • Word 97-2003/present-continuous.doc 252.9 kB
  • Word 97-2003/present-continuous_-ana.doc 1.1 MB
  • Word 97-2003/present-continuous_001.doc 65.5 kB
  • Word 97-2003/present-continuous_002.doc 229.4 kB
  • Word 97-2003/present-continuous_003.doc 45.6 kB
  • Word 97-2003/present-continuous_004.doc 226.8 kB
  • Word 97-2003/present-continuous_005.doc 57.3 kB
  • Word 97-2003/present-continuous_006.doc 169.0 kB
  • Word 97-2003/present-continuous_007.doc 126.0 kB
  • Word 97-2003/present-continuous_008.doc 504.3 kB
  • Word 97-2003/present-continuous_009.doc 671.7 kB
  • Word 97-2003/present-continuous_010.doc 3.2 MB
  • Word 97-2003/present-continuous_011.doc 1.3 MB
  • Word 97-2003/present-continuous_012.doc 169.0 kB
  • Word 97-2003/present-continuous_013.doc 99.8 kB
  • Word 97-2003/present-daily-act.doc 27.6 kB
  • Word 97-2003/present-past-simple-continuous.doc 130.6 kB
  • Word 97-2003/present-past.doc 130.6 kB
  • Word 97-2003/present-perfect-2012.doc 109.6 kB
  • Word 97-2003/present-perfect-3-forms-key.doc 139.8 kB
  • Word 97-2003/present-perfect-and-past-simple-key.doc 214.5 kB
  • Word 97-2003/present-perfect-and-past-simple.doc 60.9 kB
  • Word 97-2003/present-perfect-continuous.doc 63.0 kB
  • Word 97-2003/present-perfect-continuous_001.doc 185.3 kB
  • Word 97-2003/present-perfect-continuous_002.doc 207.9 kB
  • Word 97-2003/present-perfect-continuous_003.doc 207.4 kB
  • Word 97-2003/present-perfect-for-and-since.doc 124.4 kB
  • Word 97-2003/present-perfect-for-unfinished-past.doc 641.5 kB
  • Word 97-2003/present-perfect-natural-disaster.doc 599.0 kB
  • Word 97-2003/present-perfect-passive1.doc 129.5 kB
  • Word 97-2003/present-perfect-past-simple-used-to.doc 737.8 kB
  • Word 97-2003/present-perfect-past-simple_-ana.doc 119.8 kB
  • Word 97-2003/present-perfect-practice.doc 42.0 kB
  • Word 97-2003/present-perfect-quiz.doc 191.0 kB
  • Word 97-2003/present-perfect-revision.doc 208.9 kB
  • Word 97-2003/present-perfect-sep-2011.doc 714.2 kB
  • Word 97-2003/present-perfect-simple-or-continuous.doc 26.6 kB
  • Word 97-2003/present-perfect-simple-or-past-simple1.doc 20.5 kB
  • Word 97-2003/present-perfect-simple-vs-continuous-test-1.doc 67.6 kB
  • Word 97-2003/present-perfect-simple-vs-present-perfect.doc 143.9 kB
  • Word 97-2003/present-perfect-vs-present-perfect-continuous.doc 139.3 kB
  • Word 97-2003/present-perfect-vs-simple-past.doc 379.4 kB
  • Word 97-2003/present-perfect-vs-simple-past_001.doc 743.4 kB
  • Word 97-2003/present-perfect-worksheet.doc 65.0 kB
  • Word 97-2003/present-perfect.doc 84.5 kB
  • Word 97-2003/present-perfect1.doc 54.8 kB
  • Word 97-2003/present-perfect_001.doc 55.3 kB
  • Word 97-2003/present-perfect_002.doc 98.8 kB
  • Word 97-2003/present-perfect_003.doc 49.2 kB
  • Word 97-2003/present-perfect_004.doc 84.5 kB
  • Word 97-2003/present-perfect_usageexercises.doc 29.7 kB
  • Word 97-2003/present-perfects-songs.doc 26.6 kB
  • Word 97-2003/present-progressive-for-foture.doc 243.7 kB
  • Word 97-2003/present-progressive-for-foture_001.doc 243.7 kB
  • Word 97-2003/present-simple-2.doc 473.6 kB
  • Word 97-2003/present-simple-2011.doc 434.7 kB
  • Word 97-2003/present-simple-3-forms-key.doc 138.2 kB
  • Word 97-2003/present-simple-affirmative.doc 102.9 kB
  • Word 97-2003/present-simple-all-forms.doc 239.6 kB
  • Word 97-2003/present-simple-and-continuous-i.doc 42.0 kB
  • Word 97-2003/present-simple-and-continuous.doc 59.9 kB
  • Word 97-2003/present-simple-and-continuous_001.doc 28.7 kB
  • Word 97-2003/present-simple-and-continuous_002.doc 67.1 kB
  • Word 97-2003/present-simple-and-continuous_003.doc 31.2 kB
  • Word 97-2003/present-simple-and-continuous_004.doc 36.4 kB
  • Word 97-2003/present-simple-and-present-continuous_reading.doc 31.2 kB
  • Word 97-2003/present-simple-and.doc 37.4 kB
  • Word 97-2003/present-simple-chart.doc 315.9 kB
  • Word 97-2003/present-simple-continuous.doc 44.0 kB
  • Word 97-2003/present-simple-continuous_001.doc 290.8 kB
  • Word 97-2003/present-simple-daily-routines-frequency-adverbs.doc 137.2 kB
  • Word 97-2003/present-simple-daily-routines.doc 1.5 MB
  • Word 97-2003/present-simple-daily-routines_001.doc 286.7 kB
  • Word 97-2003/present-simple-exercises-intermediate.doc 47.6 kB
  • Word 97-2003/present-simple-exercises.doc 493.1 kB
  • Word 97-2003/present-simple-or-continuous-gap-filling-key.doc 530.9 kB
  • Word 97-2003/present-simple-or-present-continuous-key.doc 215.0 kB
  • Word 97-2003/present-simple-or-present-continuous.doc 66.0 kB
  • Word 97-2003/present-simple-positive-negative-questions.doc 3.9 MB
  • Word 97-2003/present-simple-practice.doc 767.0 kB
  • Word 97-2003/present-simple-practice_001.doc 156.2 kB
  • Word 97-2003/present-simple-questions-flashcards.doc 31.7 kB
  • Word 97-2003/present-simple-questions-game.doc 39.4 kB
  • Word 97-2003/present-simple-questions_28-enero.doc 152.6 kB
  • Word 97-2003/present-simple-rob.doc 4.4 MB
  • Word 97-2003/present-simple-simpsons.doc 234.5 kB
  • Word 97-2003/present-simple-tense.doc 118.3 kB
  • Word 97-2003/present-simple-tense_001.doc 24.1 kB
  • Word 97-2003/present-simple-tense_002.doc 48.1 kB
  • Word 97-2003/present-simple-tense_003.doc 213.0 kB
  • Word 97-2003/present-simple-tense_004.doc 212.0 kB
  • Word 97-2003/present-simple-vs-present-continuous-1.doc 78.3 kB
  • Word 97-2003/present-simple-vs-present-continuous.doc 182.8 kB
  • Word 97-2003/present-simple-vs-present-continuous_001.doc 128.5 kB
  • Word 97-2003/present-simple-vs-present-continuous_002.doc 210.4 kB
  • Word 97-2003/present-simple-vs-present-continuous_003.doc 282.6 kB
  • Word 97-2003/present-simple-vs-present-continuous_004.doc 46.6 kB
  • Word 97-2003/present-simple-vs-present-continuous_005.doc 78.3 kB
  • Word 97-2003/present-simple-vs.doc 495.6 kB
  • Word 97-2003/present-simple-worksheet.doc 55.8 kB
  • Word 97-2003/present-simple-worksheets.doc 119.3 kB
  • Word 97-2003/present-simple.doc 47.1 kB
  • Word 97-2003/present-simple_001.doc 208.4 kB
  • Word 97-2003/present-simple_002.doc 495.1 kB
  • Word 97-2003/present-simple_003.doc 436.2 kB
  • Word 97-2003/present-simple_004.doc 162.8 kB
  • Word 97-2003/present-simple_005.doc 24.6 kB
  • Word 97-2003/present-simple_006.doc 473.6 kB
  • Word 97-2003/present-simple_007.doc 429.6 kB
  • Word 97-2003/present-simple_008.doc 271.4 kB
  • Word 97-2003/present-tenses-2003.doc 58.4 kB
  • Word 97-2003/present-tenses-practise.doc 26.6 kB
  • Word 97-2003/present-tenses.doc 38.4 kB
  • Word 97-2003/present-tenses_001.doc 146.4 kB
  • Word 97-2003/present-tenses_002.doc 150.5 kB
  • Word 97-2003/present_continuous.doc 321.0 kB
  • Word 97-2003/present_continuous_001.doc 321.0 kB
  • Word 97-2003/present_perfect.doc 32.8 kB
  • Word 97-2003/present_perfect_001.doc 32.8 kB
  • Word 97-2003/present_perfect_as_it_is.doc 59.4 kB
  • Word 97-2003/present_perfect_as_it_is_001.doc 59.4 kB
  • Word 97-2003/present_perfect_past_tense.doc 22.5 kB
  • Word 97-2003/present_perfect_pictures2.doc 1.4 MB
  • Word 97-2003/present_perfect_questionnaire.doc 54.3 kB
  • Word 97-2003/present_simple_3rd_personsg.doc 27.1 kB
  • Word 97-2003/present_simple_and_present_continuous.doc 30.7 kB
  • Word 97-2003/present_simple_and_present_continuous_001.doc 30.7 kB
  • Word 97-2003/present_simple_vs_present_continuous.doc 24.1 kB
  • Word 97-2003/present_simple_vs_present_continuous_001.doc 24.1 kB
  • Word 97-2003/presentation-practice.doc 133.1 kB
  • Word 97-2003/presentationcard.doc 62.0 kB
  • Word 97-2003/pretty-colours.doc 327.7 kB
  • Word 97-2003/prettywomanshopping.doc 34.3 kB
  • Word 97-2003/printable-taboo-game.doc 176.6 kB
  • Word 97-2003/printables_-7-september.doc 74.8 kB
  • Word 97-2003/priscilla-ahn-dream.doc 23.6 kB
  • Word 97-2003/problem-cards-2003.doc 31.2 kB
  • Word 97-2003/problem-solving.doc 28.7 kB
  • Word 97-2003/processes-in-the-passive.doc 38.9 kB
  • Word 97-2003/professions_non_taboo.doc 27.6 kB
  • Word 97-2003/professions_non_taboo_001.doc 27.6 kB
  • Word 97-2003/profiles-cards.doc 252.9 kB
  • Word 97-2003/project-work.doc 48.1 kB
  • Word 97-2003/project_deat_penalty.doc 108.0 kB
  • Word 97-2003/project_third_edition_placement_test.doc 63.0 kB
  • Word 97-2003/pronoun-review.doc 32.8 kB
  • Word 97-2003/pronouns-adjective-and-personal.doc 289.3 kB
  • Word 97-2003/pronouns.doc 244.7 kB
  • Word 97-2003/pronunciation-cards-97.doc 470.5 kB
  • Word 97-2003/pronunciation_rhyming-words.doc 23.0 kB
  • Word 97-2003/prova-2-s3-final.doc 122.9 kB
  • Word 97-2003/prueba-sobre-pasado-para-3rd-year-2010.doc 27.1 kB
  • Word 97-2003/prueba.doc 540.2 kB
  • Word 97-2003/ps-pcontinuous.doc 155.1 kB
  • Word 97-2003/psych-scary-sharry.doc 185.9 kB
  • Word 97-2003/public-places.doc 204.8 kB
  • Word 97-2003/punctuation.doc 252.9 kB
  • Word 97-2003/purpose-clauses.doc 162.3 kB
  • Word 97-2003/puss-in-boots.doc 318.0 kB
  • Word 97-2003/put-the-verbs-into-the-correct-tense.doc 495.6 kB
  • Word 97-2003/puzzle-clothes.doc 36.9 kB
  • Word 97-2003/puzzle-game.doc 79.4 kB
  • Word 97-2003/puzzle-minibook-aan.doc 634.4 kB
  • Word 97-2003/qeensongexerc304sesheet.doc 32.8 kB
  • Word 97-2003/qs-people.doc 28.2 kB
  • Word 97-2003/quantifiers-many-much-a-lot-of-lots-of.doc 137.7 kB
  • Word 97-2003/quantifiers-someanyno-study-sheet-homework.doc 161.3 kB
  • Word 97-2003/quantifiers-too-many-too-much-enough-too.doc 107.5 kB
  • Word 97-2003/quantifiers.doc 31.2 kB
  • Word 97-2003/quantifiers_001.doc 90.6 kB
  • Word 97-2003/queen-the-show-lyrics-gaps.doc 348.7 kB
  • Word 97-2003/quest2.doc 64.0 kB
  • Word 97-2003/question-tags-intermediate.doc 301.6 kB
  • Word 97-2003/question-tags.doc 24.1 kB
  • Word 97-2003/question-tags_001.doc 204.3 kB
  • Word 97-2003/question-tags_002.doc 245.2 kB
  • Word 97-2003/question-tags_003.doc 205.8 kB
  • Word 97-2003/question-words-2012-1.doc 247.8 kB
  • Word 97-2003/question-words.doc 138.2 kB
  • Word 97-2003/question-words3.doc 177.7 kB
  • Word 97-2003/question-words_001.doc 26.1 kB
  • Word 97-2003/question-words_002.doc 83.5 kB
  • Word 97-2003/question-words_003.doc 408.6 kB
  • Word 97-2003/question.doc 99.8 kB
  • Word 97-2003/question_matrix.doc 32.8 kB
  • Word 97-2003/question_matrix_001.doc 32.8 kB
  • Word 97-2003/question_words.doc 19.5 kB
  • Word 97-2003/question_words_001.doc 19.5 kB
  • Word 97-2003/questions-2012-1.doc 1.0 MB
  • Word 97-2003/questions-2012.doc 878.6 kB
  • Word 97-2003/questions-and-answers.doc 244.2 kB
  • Word 97-2003/questions-cards.doc 299.0 kB
  • Word 97-2003/questions-in-the-classroom.doc 31.7 kB
  • Word 97-2003/questions.doc 80.9 kB
  • Word 97-2003/questions_-29-november.doc 760.3 kB
  • Word 97-2003/questions_001.doc 28.2 kB
  • Word 97-2003/questions_002.doc 89.1 kB
  • Word 97-2003/questions_grammar-guide.doc 1.1 MB
  • Word 97-2003/questiontags.doc 55.8 kB
  • Word 97-2003/quiz-conditional-sentences.doc 35.3 kB
  • Word 97-2003/quiz-m.doc 29.2 kB
  • Word 97-2003/quiz-on-question-spt.doc 72.2 kB
  • Word 97-2003/quiz-past-and-future.doc 138.8 kB
  • Word 97-2003/quiz-unit-3.doc 137.7 kB
  • Word 97-2003/quiz-unit-4.doc 34.3 kB
  • Word 97-2003/quiz.doc 53.2 kB
  • Word 97-2003/quiz_comp_sup.doc 40.4 kB
  • Word 97-2003/Rajiv_Shastri.doc 494.6 kB
  • Word 97-2003/raphaela-prova.doc 514.0 kB
  • Word 97-2003/razorlight.doc 26.6 kB
  • Word 97-2003/read-and-compare.doc 385.0 kB
  • Word 97-2003/read-and-draw.doc 32.3 kB
  • Word 97-2003/read-each-sentence-then-circle-the-correct-verb.doc 28.2 kB
  • Word 97-2003/read-the-information-and-draw-the-family-tree-of.doc 49.7 kB
  • Word 97-2003/read-the-information-and-draw-the-family-tree-of1.doc 52.2 kB
  • Word 97-2003/reading-about-pluto-four-skills.doc 69.6 kB
  • Word 97-2003/reading-act.doc 28.7 kB
  • Word 97-2003/reading-activity-4-3prim.doc 184.3 kB
  • Word 97-2003/reading-activity.doc 43.5 kB
  • Word 97-2003/reading-amazing-adventures.doc 764.4 kB
  • Word 97-2003/reading-colouring-hannah-montana.doc 316.9 kB
  • Word 97-2003/reading-comprehension-1.doc 63.5 kB
  • Word 97-2003/reading-comprehension-birthday.doc 80.4 kB
  • Word 97-2003/reading-comprehension-chocolate-for-all-occasions.doc 75.8 kB
  • Word 97-2003/reading-comprehension-family-describing-people.doc 358.9 kB
  • Word 97-2003/reading-comprehension.doc 32.8 kB
  • Word 97-2003/reading-did-you-know-10-neil-armstrong.doc 56.8 kB
  • Word 97-2003/reading-did-you-know-11-pope-benedict-xvi.doc 64.5 kB
  • Word 97-2003/reading-did-you-know-6-michael-phelps.doc 94.7 kB
  • Word 97-2003/reading-did-you-know-7-usain-bolt.doc 72.7 kB
  • Word 97-2003/reading-did-you-know-8-kate-middleton.doc 69.1 kB
  • Word 97-2003/reading-did-you-know-9-oscar-pistorius.doc 63.0 kB
  • Word 97-2003/reading-did-you-know-curiosity.doc 44.0 kB
  • Word 97-2003/reading-did-you-know-moon-trip.doc 55.8 kB
  • Word 97-2003/reading-did-you-know-stinky-flower.doc 54.3 kB
  • Word 97-2003/reading-did-you-know-texting-champion.doc 49.2 kB
  • Word 97-2003/reading-did-you-now-toronto.doc 46.6 kB
  • Word 97-2003/reading-exercise.doc 12.3 kB
  • Word 97-2003/reading-log.doc 36.4 kB
  • Word 97-2003/reading-strange-night.doc 269.8 kB
  • Word 97-2003/reading-teen-styles.doc 336.9 kB
  • Word 97-2003/reading-wedding.doc 131.6 kB
  • Word 97-2003/reading.doc 46.6 kB
  • Word 97-2003/reading_001.doc 494.6 kB
  • Word 97-2003/reading_comprehension_bullying.doc 194.0 kB
  • Word 97-2003/readingcomp.doc 30.7 kB
  • Word 97-2003/readingcomp_001.doc 33.8 kB
  • Word 97-2003/recipe-caramel-shortcakes-students.doc 20.0 kB
  • Word 97-2003/recipe-vocabulary-grammar.doc 33.3 kB
  • Word 97-2003/recycle-boardgame.doc 207.9 kB
  • Word 97-2003/reflexive-pronouns.doc 257.0 kB
  • Word 97-2003/reflexive-pronouns_001.doc 168.4 kB
  • Word 97-2003/regular-and-irregular.doc 36.9 kB
  • Word 97-2003/regular-past-tense-worksheet.doc 162.3 kB
  • Word 97-2003/regular-past-tense-worksheet_001.doc 168.4 kB
  • Word 97-2003/regular-verbs-game.doc 225.3 kB
  • Word 97-2003/regular.doc 229.4 kB
  • Word 97-2003/rehab.doc 21.5 kB
  • Word 97-2003/relative-clauses-non-defining-writing-exercise.doc 20.0 kB
  • Word 97-2003/relative-clauses-practice.doc 28.7 kB
  • Word 97-2003/relative-clauses.doc 59.4 kB
  • Word 97-2003/relative-clauses_001.doc 287.7 kB
  • Word 97-2003/relative-clauses_002.doc 218.6 kB
  • Word 97-2003/relative-pronouns-2.doc 63.5 kB
  • Word 97-2003/relative-pronouns.doc 269.3 kB
  • Word 97-2003/relative-pronouns_001.doc 170.5 kB
  • Word 97-2003/relative-pronouns_002.doc 118.8 kB
  • Word 97-2003/relative-pronouns_003.doc 163.3 kB
  • Word 97-2003/relative_clauses.doc 39.9 kB
  • Word 97-2003/relativos-agosto.doc 33.8 kB
  • Word 97-2003/renting-ii-color.doc 231.4 kB
  • Word 97-2003/rentviewingwkst.doc 48.1 kB
  • Word 97-2003/rephrasing-1.doc 35.3 kB
  • Word 97-2003/rephrasing-2-2186-bachiller.doc 38.9 kB
  • Word 97-2003/rephrasing-2186-bachiller.doc 34.3 kB
  • Word 97-2003/reporspeech.doc 61.4 kB
  • Word 97-2003/report-speech-2.doc 67.6 kB
  • Word 97-2003/report-these-questions-2003.doc 84.5 kB
  • Word 97-2003/reported-speech-1-statements.doc 211.5 kB
  • Word 97-2003/reported-speech-1.doc 62.0 kB
  • Word 97-2003/reported-speech-1_001.doc 64.0 kB
  • Word 97-2003/reported-speech-2-questions.doc 214.0 kB
  • Word 97-2003/reported-speech-2.doc 46.1 kB
  • Word 97-2003/reported-speech-3-special-uses.doc 212.5 kB
  • Word 97-2003/reported-speech-cards.doc 593.4 kB
  • Word 97-2003/reported-speech-dec2012.doc 104.4 kB
  • Word 97-2003/reported-speech-elementary.doc 432.1 kB
  • Word 97-2003/reported-speech-grammar-test.doc 50.7 kB
  • Word 97-2003/reported-speech-iii.doc 249.3 kB
  • Word 97-2003/reported-speech-mixed-forms.doc 214.5 kB
  • Word 97-2003/reported-speech-pimp.doc 339.5 kB
  • Word 97-2003/reported-speech-present.doc 25.6 kB
  • Word 97-2003/reported-speech-questions.doc 411.6 kB
  • Word 97-2003/reported-speech-uint.doc 25.6 kB
  • Word 97-2003/reported-speech.doc 48.1 kB
  • Word 97-2003/reported-speech3.doc 24.6 kB
  • Word 97-2003/reported-speech_001.doc 24.6 kB
  • Word 97-2003/reported-speech_002.doc 94.2 kB
  • Word 97-2003/reported-speech_003.doc 45.1 kB
  • Word 97-2003/reported-speech_004.doc 193.0 kB
  • Word 97-2003/reported-speech_005.doc 193.0 kB
  • Word 97-2003/reported-speech_006.doc 139.8 kB
  • Word 97-2003/reported-speech_007.doc 55.8 kB
  • Word 97-2003/reported-speech_2_.doc 46.1 kB
  • Word 97-2003/reported-statements-commands-and-requests-practice.doc 82.9 kB
  • Word 97-2003/reported-to-direct-speech.doc 207.9 kB
  • Word 97-2003/reported_speech.doc 24.1 kB
  • Word 97-2003/reported_speech_001.doc 24.1 kB
  • Word 97-2003/reporting-verbs.doc 105.0 kB
  • Word 97-2003/reportingchanges.doc 161.3 kB
  • Word 97-2003/resident-evil-4-afterlife.doc 121.9 kB
  • Word 97-2003/resident-evil.doc 37.9 kB
  • Word 97-2003/restaurant_role_cards.doc 28.7 kB
  • Word 97-2003/restaurant_role_cards_001.doc 28.7 kB
  • Word 97-2003/review-2a.doc 408.1 kB
  • Word 97-2003/review-and-kiss-with-a-fist.doc 48.6 kB
  • Word 97-2003/review-exercises-basic-level.doc 43.0 kB
  • Word 97-2003/review-mid-ld2.doc 68.6 kB
  • Word 97-2003/revis227o-9-ano.doc 35.3 kB
  • Word 97-2003/revising-tenses-past-simple.doc 313.3 kB
  • Word 97-2003/revision-domino.doc 1.3 MB
  • Word 97-2003/revision-final-test.doc 95.7 kB
  • Word 97-2003/revision-game-b.doc 336.9 kB
  • Word 97-2003/revision-jumbled-sentences.doc 28.2 kB
  • Word 97-2003/revision-of-tenses-10-form.doc 66.0 kB
  • Word 97-2003/revision-questions.doc 29.2 kB
  • Word 97-2003/revision.doc 35.8 kB
  • Word 97-2003/revision_001.doc 337.9 kB
  • Word 97-2003/revision_200020011.doc 46.6 kB
  • Word 97-2003/revision_200020011_001.doc 46.6 kB
  • Word 97-2003/rewrite-the-sentences-into-reported-speech.doc 45.6 kB
  • Word 97-2003/rewrite-the-sentences-into-reported-speech2.doc 55.8 kB
  • Word 97-2003/ribe.doc 1.3 MB
  • Word 97-2003/riddles-guess-the-fruit-or-vegetable.doc 57.3 kB
  • Word 97-2003/riddles.doc 45.1 kB
  • Word 97-2003/rihanna-umbrella-worksheet.doc 323.1 kB
  • Word 97-2003/robbie-williams-angel-english.doc 139.3 kB
  • Word 97-2003/robin-hood-test.doc 31.7 kB
  • Word 97-2003/robinhoodmovie_questions.doc 25.6 kB
  • Word 97-2003/robot-invasion-1.doc 442.9 kB
  • Word 97-2003/role-play-good-manners.doc 50.2 kB
  • Word 97-2003/role-play-silly-superstitions.doc 28.7 kB
  • Word 97-2003/rolling-in-the-deep-by-adele-2003.doc 43.5 kB
  • Word 97-2003/rome-wasnt-built-in-a-day.doc 379.9 kB
  • Word 97-2003/ronald-reagan.doc 378.9 kB
  • Word 97-2003/rooms-at-the-top.doc 203.8 kB
  • Word 97-2003/rooms-in-the-house.doc 186.9 kB
  • Word 97-2003/rooms.doc 612.4 kB
  • Word 97-2003/ross-and-rachel-take-emma-to-the-playground.doc 53.2 kB
  • Word 97-2003/ross-and-rachel-take-emma-to-the-playground_001.doc 51.7 kB
  • Word 97-2003/round_up_5.doc 82.9 kB
  • Word 97-2003/routinematch-true-or-false.doc 57.3 kB
  • Word 97-2003/royal-family.doc 99.8 kB
  • Word 97-2003/royal-family_001.doc 254.5 kB
  • Word 97-2003/rudy-story.doc 433.7 kB
  • Word 97-2003/rules-conditionals.doc 66.0 kB
  • Word 97-2003/rules-of-comma.doc 32.8 kB
  • Word 97-2003/run-around-sue.doc 30.2 kB
  • Word 97-2003/russian-superstitions.doc 51.7 kB
  • Word 97-2003/rycar.doc 31.7 kB
  • Word 97-2003/s-and-z-words.doc 111.1 kB
  • Word 97-2003/saca.doc 117.8 kB
  • Word 97-2003/safety-equipment.doc 32.3 kB
  • Word 97-2003/said.doc 62.5 kB
  • Word 97-2003/saint-patrick-bis.doc 38.4 kB
  • Word 97-2003/saint-patrick.doc 50.7 kB
  • Word 97-2003/saint-patrick_001.doc 54.8 kB
  • Word 97-2003/sample-listening-test.doc 25.1 kB
  • Word 97-2003/sample-listening-testanswers.doc 25.1 kB
  • Word 97-2003/sandwich-making.doc 512.0 kB
  • Word 97-2003/save-the-world.doc 68.6 kB
  • Word 97-2003/say-tell-talk-speak.doc 105.0 kB
  • Word 97-2003/say-tell-talk-speak_001.doc 86.0 kB
  • Word 97-2003/saytell-etc.doc 109.1 kB
  • Word 97-2003/school-objects-and-personal-information-1.doc 384.5 kB
  • Word 97-2003/school-puzzle-key.doc 406.0 kB
  • Word 97-2003/school-rooms-there-to-be.doc 79.9 kB
  • Word 97-2003/school-rules.doc 228.4 kB
  • Word 97-2003/school-subjects.doc 676.9 kB
  • Word 97-2003/school-subjects_001.doc 544.8 kB
  • Word 97-2003/school-subjects_002.doc 27.6 kB
  • Word 97-2003/school-suplies.doc 331.3 kB
  • Word 97-2003/school-supplies.doc 251.4 kB
  • Word 97-2003/school-things-rhyme-blanks.doc 24.6 kB
  • Word 97-2003/school-uniform.doc 31.7 kB
  • Word 97-2003/school.doc 160.3 kB
  • Word 97-2003/school_001.doc 38.9 kB
  • Word 97-2003/school_speaking_writing_adj_adjectives.doc 904.7 kB
  • Word 97-2003/scotland.doc 152.1 kB
  • Word 97-2003/scrabble-phonics-upload.doc 33.3 kB
  • Word 97-2003/scrabble.doc 707.6 kB
  • Word 97-2003/scrambled-olympic-sports.doc 145.4 kB
  • Word 97-2003/sdandrovocimplangpres.doc 23.6 kB
  • Word 97-2003/seasons-in-the-sun.doc 26.1 kB
  • Word 97-2003/seasons-weather-school.doc 210.9 kB
  • Word 97-2003/seasons-weathermine.doc 181.2 kB
  • Word 97-2003/seasons.doc 244.8 kB
  • Word 97-2003/seasons_001.doc 187.9 kB
  • Word 97-2003/second-conditional-2012.doc 59.9 kB
  • Word 97-2003/second-conditional.doc 164.6 kB
  • Word 97-2003/second-conditional_001.doc 65.5 kB
  • Word 97-2003/second-test.doc 280.6 kB
  • Word 97-2003/secret-of-the-wings-tinker-bell.doc 1.4 MB
  • Word 97-2003/self-assessment-sheet.doc 205.3 kB
  • Word 97-2003/sentence-transformations-for-pet.doc 33.8 kB
  • Word 97-2003/sentence-transformations-ws-key.doc 36.4 kB
  • Word 97-2003/sentence.doc 75.3 kB
  • Word 97-2003/sentences-simple-past-present-perfect.doc 27.6 kB
  • Word 97-2003/sequencing-activity.doc 91.6 kB
  • Word 97-2003/set-fire-to-the-rain.doc 1.0 MB
  • Word 97-2003/shape-of-my-heart.doc 29.7 kB
  • Word 97-2003/shapes.doc 29.2 kB
  • Word 97-2003/shapes2.doc 214.0 kB
  • Word 97-2003/shapes_001.doc 277.0 kB
  • Word 97-2003/she-is-my-mother.doc 77.3 kB
  • Word 97-2003/she-loves-you.doc 206.8 kB
  • Word 97-2003/sheet.doc 161.3 kB
  • Word 97-2003/sheet_001.doc 39.9 kB
  • Word 97-2003/sheikh-mohammed-poems.doc 410.1 kB
  • Word 97-2003/shejps-majn.doc 356.9 kB
  • Word 97-2003/shopping-pictures-and-prices.doc 277.5 kB
  • Word 97-2003/shopping-questionnaire.doc 74.2 kB
  • Word 97-2003/shopping-video-activity.doc 139.3 kB
  • Word 97-2003/shopping.doc 166.4 kB
  • Word 97-2003/shops.doc 201.2 kB
  • Word 97-2003/short-answers-present-past-simple-and-continuous.doc 28.7 kB
  • Word 97-2003/short-answers-presents.doc 27.1 kB
  • Word 97-2003/short-story-analysis-.doc 53.8 kB
  • Word 97-2003/short-story.doc 231.9 kB
  • Word 97-2003/short-vowel-sound.doc 190.0 kB
  • Word 97-2003/short-vowels.doc 352.8 kB
  • Word 97-2003/short_answers_-_to_be_-_board_game1.doc 41.5 kB
  • Word 97-2003/short_vowel_sounds.doc 88.1 kB
  • Word 97-2003/should-have-shouldnt-have.doc 280.1 kB
  • Word 97-2003/should-shouldent.doc 376.3 kB
  • Word 97-2003/shrek-2.doc 37.9 kB
  • Word 97-2003/sick-of-love.doc 21.0 kB
  • Word 97-2003/signs-of-the-zodiac.doc 97.3 kB
  • Word 97-2003/silent_letter.doc 272.0 kB
  • Word 97-2003/silent_letter_001.doc 272.0 kB
  • Word 97-2003/silly_tongue_twister.doc 42.0 kB
  • Word 97-2003/similes.doc 32.8 kB
  • Word 97-2003/simple-future-harry-potter.doc 33.8 kB
  • Word 97-2003/simple-or-cont-multiple-choice.doc 341.5 kB
  • Word 97-2003/simple-past-and-past-continuous-tenses.doc 25.1 kB
  • Word 97-2003/simple-past-build-up-exercise.doc 24.1 kB
  • Word 97-2003/simple-past-lesson.doc 1.3 MB
  • Word 97-2003/simple-past-or-past-perfect.doc 131.1 kB
  • Word 97-2003/simple-past-stories.doc 91.1 kB
  • Word 97-2003/simple-past-tense-ec-club-msw.doc 118.3 kB
  • Word 97-2003/simple-past-tense.doc 274.9 kB
  • Word 97-2003/simple-past-test.doc 290.3 kB
  • Word 97-2003/simple-past-vs-present-perfect.doc 106.0 kB
  • Word 97-2003/simple-past-vs-present-perfect_001.doc 62.0 kB
  • Word 97-2003/simple-past-worksheet.doc 3.3 MB
  • Word 97-2003/simple-past.doc 110.1 kB
  • Word 97-2003/simple-past_001.doc 226.3 kB
  • Word 97-2003/simple-past_002.doc 36.4 kB
  • Word 97-2003/simple-past_003.doc 2.4 MB
  • Word 97-2003/simple-past_004.doc 169.5 kB
  • Word 97-2003/simple-present-pronounsadjectives.doc 53.8 kB
  • Word 97-2003/simple-present-tense-and-present-progressive.doc 309.8 kB
  • Word 97-2003/simple-present-vs-present-progressive.doc 56.3 kB
  • Word 97-2003/simple-present-vs-progressive-tense.doc 281.1 kB
  • Word 97-2003/simple-present-with-pictures-1.doc 355.3 kB
  • Word 97-2003/simple-present.doc 27.6 kB
  • Word 97-2003/simple-present_001.doc 25.1 kB
  • Word 97-2003/simple-present_002.doc 31.2 kB
  • Word 97-2003/simple-presentfill-in-.doc 44.0 kB
  • Word 97-2003/simple-sentences-1.doc 45.6 kB
  • Word 97-2003/simple-short-test.doc 23.0 kB
  • Word 97-2003/simple-tenses.doc 28.7 kB
  • Word 97-2003/simple_past_past_cont.doc 50.7 kB
  • Word 97-2003/simple_present_summary.doc 55.3 kB
  • Word 97-2003/simple_present_summary_001.doc 55.3 kB
  • Word 97-2003/simple_present_tests_full.doc 102.4 kB
  • Word 97-2003/simple_present_tests_full_001.doc 102.4 kB
  • Word 97-2003/simple_present_tests_full_002.doc 102.4 kB
  • Word 97-2003/simplevscontinuous.doc 28.2 kB
  • Word 97-2003/simpsons-family-tree-complete-gaps.doc 777.2 kB
  • Word 97-2003/simpsons.doc 203.3 kB
  • Word 97-2003/since-for1.doc 256.0 kB
  • Word 97-2003/situations-2.doc 27.1 kB
  • Word 97-2003/situations.doc 28.7 kB
  • Word 97-2003/situations_001.doc 28.7 kB
  • Word 97-2003/skaic-lentele.doc 90.1 kB
  • Word 97-2003/skaterboy_possessive.doc 44.0 kB
  • Word 97-2003/skills-informal-letter-apologizing-for-telling-a.doc 36.4 kB
  • Word 97-2003/skills-informal-letter-apologizing-for-telling-a_001.doc 25.6 kB
  • Word 97-2003/skills.doc 63.5 kB
  • Word 97-2003/skills_001.doc 64.0 kB
  • Word 97-2003/skin-by-roald-dahl-test.doc 52.7 kB
  • Word 97-2003/Skin_by_Roald_Dahl_-_Test.doc 48.6 kB
  • Word 97-2003/skorogovorka-th.doc 2.0 MB
  • Word 97-2003/skyfall-by-adele.doc 235.5 kB
  • Word 97-2003/skyfall.doc 67.6 kB
  • Word 97-2003/slang-expressions.doc 93.2 kB
  • Word 97-2003/slang-informal-english.doc 487.9 kB
  • Word 97-2003/slangs.doc 304.6 kB
  • Word 97-2003/slavery-ex-esl-printables.doc 505.9 kB
  • Word 97-2003/slides-and-ladders.doc 41.5 kB
  • Word 97-2003/sliding-doors_worksheet.doc 50.7 kB
  • Word 97-2003/slo-wispelberg-les-2-martha-stewart-transcript.doc 32.3 kB
  • Word 97-2003/slovesa_neprav15prav15.doc 47.6 kB
  • Word 97-2003/slp2_F12_8_27_-_31.doc 41.5 kB
  • Word 97-2003/small-jokes-for-children.doc 467.5 kB
  • Word 97-2003/smile-iii-reported-speech.doc 241.7 kB
  • Word 97-2003/smile.doc 272.4 kB
  • Word 97-2003/snakes-and-ladders-passive-voice.doc 115.2 kB
  • Word 97-2003/snakes-and-ladders-past-continuous.doc 159.7 kB
  • Word 97-2003/snakes-ladders.doc 113.2 kB
  • Word 97-2003/snow_on_my_roof.doc 23.0 kB
  • Word 97-2003/snowman88.doc 329.2 kB
  • Word 97-2003/snr3unit8.doc 243.2 kB
  • Word 97-2003/some-and-any.doc 252.9 kB
  • Word 97-2003/some-any-food-verb-to-like.doc 182.3 kB
  • Word 97-2003/some-any-no.doc 95.2 kB
  • Word 97-2003/some-anyt.doc 55.3 kB
  • Word 97-2003/some-general-practice-for-levelling_intermediate.doc 32.8 kB
  • Word 97-2003/some-or-any.doc 79.9 kB
  • Word 97-2003/some-popular-american-holidays.doc 474.6 kB
  • Word 97-2003/some-rules-of-gerunds-and-infinitives.doc 59.4 kB
  • Word 97-2003/someany.doc 24.1 kB
  • Word 97-2003/someany_001.doc 24.1 kB
  • Word 97-2003/somebody-to-love.doc 1.3 MB
  • Word 97-2003/someone-like-you-worksheet-by-adele.doc 41.5 kB
  • Word 97-2003/someone-was.doc 98.8 kB
  • Word 97-2003/someone-was_001.doc 99.3 kB
  • Word 97-2003/something-more-nick-vujicic-d.doc 32.8 kB
  • Word 97-2003/song-activity-angie-the-rolling-stones.doc 82.4 kB
  • Word 97-2003/song-activity-worksheet.doc 58.4 kB
  • Word 97-2003/song-beyonce-broken-hearted-girl.doc 102.9 kB
  • Word 97-2003/song-beyonce-broken-hearted-girl_001.doc 102.9 kB
  • Word 97-2003/song-bruno-mars-just-the-way-you-are.doc 321.5 kB
  • Word 97-2003/song-by-b-marley-war-mp-esl.doc 265.7 kB
  • Word 97-2003/song-daddy-worksheet.doc 36.9 kB
  • Word 97-2003/song-firework.doc 247.3 kB
  • Word 97-2003/song-for-dad-handout-.doc 38.9 kB
  • Word 97-2003/song-give-me-all-your-luvinst.doc 22.5 kB
  • Word 97-2003/song-justin-bieber.doc 164.9 kB
  • Word 97-2003/song-justin-bieber_001.doc 164.9 kB
  • Word 97-2003/song-katy-perry-firework.doc 268.3 kB
  • Word 97-2003/song-linkin-park-twilight.doc 269.8 kB
  • Word 97-2003/song-my-love-is-your-love-whitney-huston.doc 134.1 kB
  • Word 97-2003/song-report-hw.doc 157.7 kB
  • Word 97-2003/song-robbie-williams-and-gary-barlow-shame.doc 204.8 kB
  • Word 97-2003/song-stand-by-me-.doc 86.5 kB
  • Word 97-2003/song-wet-wet-wet-love-is-all-around.doc 314.9 kB
  • Word 97-2003/song-without-youdavid-guetta-feat-usher.doc 227.8 kB
  • Word 97-2003/song-worksheet-feel-by-robbie-williams.doc 119.3 kB
  • Word 97-2003/song-worksheet-leave-out-all-the-rest.doc 41.5 kB
  • Word 97-2003/song-worksheet_uprising-by-muse.doc 49.7 kB
  • Word 97-2003/song.doc 31.7 kB
  • Word 97-2003/song_001.doc 30.7 kB
  • Word 97-2003/song_newyorknewyork.doc 41.5 kB
  • Word 97-2003/songs-violet-hill-the-gunners-dream.doc 40.4 kB
  • Word 97-2003/songs.doc 1.3 MB
  • Word 97-2003/sopa.doc 280.1 kB
  • Word 97-2003/sosick.doc 76.3 kB
  • Word 97-2003/sounds-ai-ei.doc 44.0 kB
  • Word 97-2003/sounds-of-english-for-baltic-slavonic-language.doc 39.4 kB
  • Word 97-2003/sounds.doc 38.9 kB
  • Word 97-2003/space-exploration-prompts-for-writing.doc 157.2 kB
  • Word 97-2003/spain_goya_awards.doc 43.0 kB
  • Word 97-2003/spanish-traffic-police-upset-over-pay-cut.doc 28.7 kB
  • Word 97-2003/speaking-activity.doc 26.6 kB
  • Word 97-2003/speaking-beginner.doc 97.8 kB
  • Word 97-2003/speaking-material_travel_.doc 27.1 kB
  • Word 97-2003/speaking-module.doc 27.1 kB
  • Word 97-2003/special-buildings-burj-khalifa.doc 29.7 kB
  • Word 97-2003/speding-time-with-family.doc 22.5 kB
  • Word 97-2003/speed-dating-with-modal-can.doc 65.0 kB
  • Word 97-2003/spelling-ed-wksht.doc 33.8 kB
  • Word 97-2003/spelling-er-est-wksht.doc 33.8 kB
  • Word 97-2003/spelling-ing-wksht.doc 33.8 kB
  • Word 97-2003/spelling-snakes-and-ladders.doc 189.4 kB
  • Word 97-2003/spooky-story.doc 5.5 MB
  • Word 97-2003/sport-guessing-game.doc 21.0 kB
  • Word 97-2003/sport.doc 1.2 MB
  • Word 97-2003/sports-and-games.doc 920.6 kB
  • Word 97-2003/sports-and-hobbies.doc 657.4 kB
  • Word 97-2003/sports-animals-pict.doc 391.2 kB
  • Word 97-2003/sports-equipment.doc 127.5 kB
  • Word 97-2003/sports-equipment_001.doc 131.6 kB
  • Word 97-2003/sports-label-the-pics.doc 440.3 kB
  • Word 97-2003/sports-poster-2012.doc 643.6 kB
  • Word 97-2003/sports.doc 214.5 kB
  • Word 97-2003/sports_001.doc 421.4 kB
  • Word 97-2003/sports_002.doc 168.4 kB
  • Word 97-2003/sports_003.doc 21.0 kB
  • Word 97-2003/spot.doc 24.6 kB
  • Word 97-2003/spotkania.doc 33.8 kB
  • Word 97-2003/spring.doc 198.1 kB
  • Word 97-2003/sravni.doc 649.2 kB
  • Word 97-2003/ss2-unit16.doc 933.9 kB
  • Word 97-2003/ssimplepresent.doc 24.6 kB
  • Word 97-2003/st-patrick-matc.doc 835.1 kB
  • Word 97-2003/st.doc 23.6 kB
  • Word 97-2003/st_001.doc 39.4 kB
  • Word 97-2003/stacie-orrico-i-promise-i-will-lyrics.doc 1.7 MB
  • Word 97-2003/star-of-the-month-2.doc 786.4 kB
  • Word 97-2003/stars-signs.doc 45.1 kB
  • Word 97-2003/starstruck-ejercicio.doc 29.7 kB
  • Word 97-2003/stay-at-the-mountains.doc 691.7 kB
  • Word 97-2003/stay-with-you-by-john-legend.doc 33.8 kB
  • Word 97-2003/stegosaurus-while-watching-activity.doc 55.8 kB
  • Word 97-2003/step-by-step-103-part-1.doc 569.9 kB
  • Word 97-2003/stereo-hearts-lyrics-done.doc 27.6 kB
  • Word 97-2003/stereo-hearts-lyrics.doc 27.6 kB
  • Word 97-2003/stereotype_feladatlap.doc 784.9 kB
  • Word 97-2003/sterling-knights-hero.doc 1.6 MB
  • Word 97-2003/sting-fields-of-gold.doc 25.1 kB
  • Word 97-2003/story-writing-planning-sheet.doc 230.4 kB
  • Word 97-2003/story.doc 24.6 kB
  • Word 97-2003/storyprompts.doc 138.2 kB
  • Word 97-2003/stpatricksday.doc 114.2 kB
  • Word 97-2003/stpatricksday_cloze.doc 116.2 kB
  • Word 97-2003/stpatricksday_rhymes.doc 158.7 kB
  • Word 97-2003/stpatricksday_wordsearch.doc 313.3 kB
  • Word 97-2003/strine-australian-slang.doc 39.4 kB
  • Word 97-2003/stronger-activities-by-nelly-clarkson.doc 65.5 kB
  • Word 97-2003/stronger-kelly-clarckson.doc 30.7 kB
  • Word 97-2003/student-have-got.doc 394.8 kB
  • Word 97-2003/student-have-got_001.doc 394.8 kB
  • Word 97-2003/student-id-card.doc 40.4 kB
  • Word 97-2003/subject-object-pronouns.doc 129.5 kB
  • Word 97-2003/subject-object-questions.doc 1.3 MB
  • Word 97-2003/subject-possessive-saxon-key.doc 89.6 kB
  • Word 97-2003/subject-pronouns.doc 453.6 kB
  • Word 97-2003/subject-verb-noun.doc 510.0 kB
  • Word 97-2003/suff-pref.doc 26.6 kB
  • Word 97-2003/summer-holiday.doc 98.8 kB
  • Word 97-2003/summer-holidays-travelling-brainstormer.doc 114.7 kB
  • Word 97-2003/summer.doc 193.5 kB
  • Word 97-2003/summer_001.doc 23.0 kB
  • Word 97-2003/sunshine-song.doc 33.8 kB
  • Word 97-2003/super_size_me-worksheet-1.doc 48.6 kB
  • Word 97-2003/supergrass-alright.doc 318.5 kB
  • Word 97-2003/superlative-speaking-cards.doc 36.9 kB
  • Word 97-2003/superlative-speaking-cards_001.doc 38.9 kB
  • Word 97-2003/superlatives-quiz-questions.doc 20.0 kB
  • Word 97-2003/supernatural.doc 81.9 kB
  • Word 97-2003/supersizeme-worksheet-axs-2012.doc 267.8 kB
  • Word 97-2003/superstitions-about-gifts.doc 1.3 MB
  • Word 97-2003/survey-household-chores.doc 38.9 kB
  • Word 97-2003/survey.doc 62.0 kB
  • Word 97-2003/survive-stress.doc 41.5 kB
  • Word 97-2003/survivor-choose-who-to-save.doc 46.6 kB
  • Word 97-2003/susan-in-her-bedroom-1.doc 110.6 kB
  • Word 97-2003/susans-first-school-trip.doc 72.7 kB
  • Word 97-2003/suzanne-vega-toms-diner.doc 616.4 kB
  • Word 97-2003/suzanne-vega-toms-diner_001.doc 69.6 kB
  • Word 97-2003/swappy-roleplays-for-adults-1.doc 279.6 kB
  • Word 97-2003/swappy-roleplays-for-adults-2-bw-version-included.doc 275.5 kB
  • Word 97-2003/swappy-roleplays-for-adults-3-bw-version-included.doc 230.9 kB
  • Word 97-2003/sweet-child-o-mine-activities.doc 27.6 kB
  • Word 97-2003/swicthfoot-your-love-is-a-song-present-cont.doc 13.3 kB
  • Word 97-2003/syllabication-rules.doc 18.9 kB
  • Word 97-2003/synonyms-antonyms-worksheet.doc 31.2 kB
  • Word 97-2003/sz246vegkieg233sz237t233sek.doc 258.0 kB
  • Word 97-2003/taboo-game-02.doc 184.3 kB
  • Word 97-2003/taboo-game-03.doc 188.4 kB
  • Word 97-2003/taboo-worklife-intermediate.doc 81.4 kB
  • Word 97-2003/taboo1.doc 64.0 kB
  • Word 97-2003/tabooo-lili1.doc 64.5 kB
  • Word 97-2003/take-me-to-your-heart.doc 73.2 kB
  • Word 97-2003/talking-about-abilities-by-z233di.doc 73.2 kB
  • Word 97-2003/talking-about-clothes.doc 27.1 kB
  • Word 97-2003/talking-about-future.doc 557.6 kB
  • Word 97-2003/talking-about-the-past.doc 20.0 kB
  • Word 97-2003/talking.doc 74.2 kB
  • Word 97-2003/taller-to-print.doc 53.2 kB
  • Word 97-2003/tangled-activities.doc 358.9 kB
  • Word 97-2003/tangled-game.doc 32.3 kB
  • Word 97-2003/tangled.doc 290.3 kB
  • Word 97-2003/tarea1-present-continuous.doc 218.1 kB
  • Word 97-2003/tarot.doc 2.0 MB
  • Word 97-2003/tasks-to-the-song-you-are-my-everything.doc 29.7 kB
  • Word 97-2003/tattoo-art-reading-comprehension.doc 158.7 kB
  • Word 97-2003/taxing-marijuana-in-california.doc 25.1 kB
  • Word 97-2003/te-lesson-5.doc 260.6 kB
  • Word 97-2003/te-lesson-6esl.doc 193.0 kB
  • Word 97-2003/tea.doc 167.9 kB
  • Word 97-2003/tears-in-heaven-lyrics.doc 26.6 kB
  • Word 97-2003/technologies.doc 178.2 kB
  • Word 97-2003/ted-talks.doc 29.2 kB
  • Word 97-2003/teens_1_timezones_unit_5can_cant_dfff.doc 33.3 kB
  • Word 97-2003/teksty-dlya-chteniya.doc 28.2 kB
  • Word 97-2003/telepathy.doc 30.7 kB
  • Word 97-2003/telephoning-song-listening-pre.doc 108.0 kB
  • Word 97-2003/telephoning-terms-glossary-.doc 37.9 kB
  • Word 97-2003/tell-the-time.doc 129.5 kB
  • Word 97-2003/tell-the-truth-tell-a-lie.doc 43.0 kB
  • Word 97-2003/tell-us-about-adults.doc 271.9 kB
  • Word 97-2003/tell-your-fellow-students-about-yourself.doc 84.0 kB
  • Word 97-2003/telling-the-time.doc 95.7 kB
  • Word 97-2003/telling-the-time_001.doc 96.3 kB
  • Word 97-2003/telling-the-time_002.doc 45.6 kB
  • Word 97-2003/tense-revision-bachillerato.doc 50.7 kB
  • Word 97-2003/tense-revision.doc 26.6 kB
  • Word 97-2003/tenses-exercises.doc 35.8 kB
  • Word 97-2003/tenses-revision.doc 36.4 kB
  • Word 97-2003/tenses_concept_questions_.doc 16.4 kB
  • Word 97-2003/tenses_prpastperffut.doc 56.8 kB
  • Word 97-2003/term01_test01_20012002.doc 29.7 kB
  • Word 97-2003/term01_test01_20012002_001.doc 29.7 kB
  • Word 97-2003/terrible-job-interview-should.doc 32.3 kB
  • Word 97-2003/test-2-kl.doc 41.5 kB
  • Word 97-2003/test-2.doc 38.4 kB
  • Word 97-2003/test-3-kl-past.doc 39.9 kB
  • Word 97-2003/test-5.doc 26.1 kB
  • Word 97-2003/test-5th-grade.doc 82.4 kB
  • Word 97-2003/test-body.doc 632.8 kB
  • Word 97-2003/test-britain.doc 56.3 kB
  • Word 97-2003/test-direct_indirect-speech.doc 22.0 kB
  • Word 97-2003/test-dlya-fizikov-1-2.doc 496.1 kB
  • Word 97-2003/test-dlya-fizikov-1-2_001.doc 496.1 kB
  • Word 97-2003/test-for-4-grades.doc 121.9 kB
  • Word 97-2003/test-for-basic-skills.doc 199.7 kB
  • Word 97-2003/test-on-articles.doc 52.7 kB
  • Word 97-2003/test-on-pr-simple-and-progressive.doc 34.8 kB
  • Word 97-2003/test-past-tenses.doc 27.1 kB
  • Word 97-2003/test-prep-phrasal.doc 29.2 kB
  • Word 97-2003/test-present-simple-5.doc 47.6 kB
  • Word 97-2003/test-robin-hood-a7a.doc 25.1 kB
  • Word 97-2003/test-sur-les-temps.doc 27.1 kB
  • Word 97-2003/test-the-addams-2o10.doc 1.4 MB
  • Word 97-2003/test-u-4-and-6-snapshot.doc 529.9 kB
  • Word 97-2003/test-unit-3-stardust-3.doc 268.8 kB
  • Word 97-2003/test.doc 253.4 kB
  • Word 97-2003/test4-6170-a.doc 101.9 kB
  • Word 97-2003/test62009_9thprintable.doc 47.1 kB
  • Word 97-2003/test62009_9thprintable_001.doc 47.1 kB
  • Word 97-2003/test_001.doc 250.4 kB
  • Word 97-2003/test_002.doc 60.4 kB
  • Word 97-2003/test_003.doc 395.8 kB
  • Word 97-2003/test_004.doc 42.5 kB
  • Word 97-2003/test_005.doc 42.5 kB
  • Word 97-2003/test_persuasion.doc 22.5 kB
  • Word 97-2003/test_wishes.doc 24.1 kB
  • Word 97-2003/teste10186-nov-key.doc 135.2 kB
  • Word 97-2003/text-meeting.doc 137.2 kB
  • Word 97-2003/text-review.doc 36.9 kB
  • Word 97-2003/thanksgiving-booklet-2011.doc 2.2 MB
  • Word 97-2003/thanksgiving-crossword.doc 298.0 kB
  • Word 97-2003/thanksgiving-pictionary.doc 401.4 kB
  • Word 97-2003/thanksgiving-pictionary_001.doc 401.4 kB
  • Word 97-2003/thanksgiving.doc 615.4 kB
  • Word 97-2003/thanksgiving_001.doc 36.9 kB
  • Word 97-2003/thanksgiving_002.doc 37.4 kB
  • Word 97-2003/thanksgiving_003.doc 144.9 kB
  • Word 97-2003/that-i-would-be-good.doc 27.6 kB
  • Word 97-2003/thats-all.doc 30.2 kB
  • Word 97-2003/thats-my-village-key.doc 269.8 kB
  • Word 97-2003/the-abc-of-happiness.doc 11.8 kB
  • Word 97-2003/the-amazing-adventures-of-mr-bean.doc 24.6 kB
  • Word 97-2003/the-american-dream.doc 77.8 kB
  • Word 97-2003/the-analysis-of-the-text.doc 855.0 kB
  • Word 97-2003/the-articles.doc 32.8 kB
  • Word 97-2003/the-bathroom.doc 298.0 kB
  • Word 97-2003/the-bedroom.doc 230.9 kB
  • Word 97-2003/the-bedroom_001.doc 130.0 kB
  • Word 97-2003/the-best-holiday-of-my-life.doc 366.1 kB
  • Word 97-2003/the-big-bang-theory-activity-s3-e15.doc 749.1 kB
  • Word 97-2003/the-big-bang-theory-s1e1.doc 188.4 kB
  • Word 97-2003/the-body.doc 138.2 kB
  • Word 97-2003/the-bright-blue-book.doc 48.6 kB
  • Word 97-2003/the-british-isles.doc 97.3 kB
  • Word 97-2003/the-city-is-ouuuur-ouuuur-ouuuurs.doc 631.8 kB
  • Word 97-2003/the-climb-miley-cyrus.doc 233.5 kB
  • Word 97-2003/the-clown-is-jumping.doc 4.1 MB
  • Word 97-2003/the-comparative-with-modifiers.doc 110.1 kB
  • Word 97-2003/the-comparison-of-superiority-practice-key.doc 421.4 kB
  • Word 97-2003/the-corpse-bride.doc 41.5 kB
  • Word 97-2003/the-corrs.doc 44.5 kB
  • Word 97-2003/the-cure-friday-beg-iii.doc 86.0 kB
  • Word 97-2003/the-cure-lovesong.doc 45.6 kB
  • Word 97-2003/the-double-comparative-structure.doc 58.4 kB
  • Word 97-2003/the-email2012.doc 47.1 kB
  • Word 97-2003/the-environment-endangered-species-fauna.doc 44.0 kB
  • Word 97-2003/the-environment-rephrasing-key.doc 149.5 kB
  • Word 97-2003/the-environment.doc 149.5 kB
  • Word 97-2003/the-face-missing-letters.doc 222.7 kB
  • Word 97-2003/the-face.doc 248.8 kB
  • Word 97-2003/the-family-is-sleeping.doc 25.1 kB
  • Word 97-2003/the-family.doc 194.6 kB
  • Word 97-2003/the-fantastic-4-lp62.doc 57.3 kB
  • Word 97-2003/the-fellowship-of-the-ring.doc 80.9 kB
  • Word 97-2003/the-food-pyramid.doc 111.6 kB
  • Word 97-2003/the-food.doc 173.1 kB
  • Word 97-2003/the-friendship-algorithm.doc 96.3 kB
  • Word 97-2003/the-fruits.doc 177.2 kB
  • Word 97-2003/the-future-resumen.doc 72.7 kB
  • Word 97-2003/the-future-tenses-practice.doc 43.5 kB
  • Word 97-2003/the-game-of-their-lives.doc 24.6 kB
  • Word 97-2003/the-great-race-with-definition.doc 158.2 kB
  • Word 97-2003/the-history-of-valentines-day.doc 152.1 kB
  • Word 97-2003/the-history-of-wikipedia.doc 31.2 kB
  • Word 97-2003/the-house.doc 95.7 kB
  • Word 97-2003/the-houses.doc 174.1 kB
  • Word 97-2003/the-iron-lady-worksheet.doc 106.0 kB
  • Word 97-2003/the-jellybean-creative-writing.doc 34.8 kB
  • Word 97-2003/the-kitchen.doc 253.4 kB
  • Word 97-2003/the-labyrinth-game-2.doc 2.0 MB
  • Word 97-2003/the-labyrinth-game.doc 9.4 MB
  • Word 97-2003/the-lake-district.doc 59.4 kB
  • Word 97-2003/the-last-one-friends.doc 51.2 kB
  • Word 97-2003/the-lazy-song-activity-ing-contractions.doc 24.6 kB
  • Word 97-2003/the-life-of-david-gale.doc 25.1 kB
  • Word 97-2003/the-lion-king.doc 31.7 kB
  • Word 97-2003/the-little-fish-who-wanted-to-be-beautiful.doc 121.3 kB
  • Word 97-2003/the-logical-song.doc 69.6 kB
  • Word 97-2003/the-london-underground-alphabetical-order-ir17.doc 39.4 kB
  • Word 97-2003/the-luncheon-tasks.doc 60.9 kB
  • Word 97-2003/the-man-who-cant-be-moved.doc 654.3 kB
  • Word 97-2003/the-marquis-and-miss-sally-worksheet.doc 170.5 kB
  • Word 97-2003/the-media-for-busyteacher.doc 1.2 MB
  • Word 97-2003/the-money-pit.doc 127.0 kB
  • Word 97-2003/the-motivational-family-story-about-the-tiny-frogs.doc 59.4 kB
  • Word 97-2003/the-number-game.doc 162.3 kB
  • Word 97-2003/the-occupy-movement.doc 296.4 kB
  • Word 97-2003/the-office-error-analysis.doc 481.8 kB
  • Word 97-2003/the-olympic-games.doc 77.3 kB
  • Word 97-2003/the-one-that-got-away.doc 44.5 kB
  • Word 97-2003/the-only-exception.doc 31.7 kB
  • Word 97-2003/the-origins-of-valentine.doc 29.2 kB
  • Word 97-2003/the-passive-voice-advanced-with-key.doc 29.7 kB
  • Word 97-2003/the-passive-voice-key.doc 1.0 MB
  • Word 97-2003/the-passive-voice-test.doc 25.1 kB
  • Word 97-2003/the-passive-voice-with-past-continuous.doc 112.1 kB
  • Word 97-2003/the-passive-voice-with-present-perfect.doc 100.9 kB
  • Word 97-2003/the-past-of-to-be.doc 405.5 kB
  • Word 97-2003/the-phantom-at-the-building.doc 26.1 kB
  • Word 97-2003/the-phantom-of-the-opera-plan.doc 48.1 kB
  • Word 97-2003/the-phrasal-verbs.doc 52.2 kB
  • Word 97-2003/the-place-of-adverbs-in-the-sentences.doc 67.6 kB
  • Word 97-2003/the-point-game.doc 28.2 kB
  • Word 97-2003/the-present-perfect-tense.doc 24.1 kB
  • Word 97-2003/the-present-perfect-vs.doc 23.0 kB
  • Word 97-2003/the-promise.doc 29.2 kB
  • Word 97-2003/the-rabbit-on-the-moon-minibook.doc 567.3 kB
  • Word 97-2003/the-reported-speech-game.doc 37.4 kB
  • Word 97-2003/the-scientist-2.doc 56.3 kB
  • Word 97-2003/the-script.doc 81.4 kB
  • Word 97-2003/the-seasons.doc 122.9 kB
  • Word 97-2003/the-simposons-family-tree.doc 413.2 kB
  • Word 97-2003/the-simpsons-crossword-practice-genitive-and-have.doc 257.5 kB
  • Word 97-2003/the-simpsons-stammbaum-arbeitsblatt.doc 50.2 kB
  • Word 97-2003/the-simpsons.doc 71.2 kB
  • Word 97-2003/the-simpsons_001.doc 191.0 kB
  • Word 97-2003/the-strokes.doc 29.2 kB
  • Word 97-2003/the-subjective-infinitive-construction.doc 24.1 kB
  • Word 97-2003/the-supermarket-growing-food-on-its-roof.doc 71.2 kB
  • Word 97-2003/the-time.doc 266.2 kB
  • Word 97-2003/the-toy-story-3-intr.doc 185.3 kB
  • Word 97-2003/the-toy-story-3-l1.doc 249.9 kB
  • Word 97-2003/the-true-test-of-friendship.doc 31.7 kB
  • Word 97-2003/the-typical-millionaire.doc 1.5 MB
  • Word 97-2003/the-united-nations.doc 47.6 kB
  • Word 97-2003/the-universe.doc 88.1 kB
  • Word 97-2003/the-vampire-diaries-season-1-episode-1-worksheet.doc 971.8 kB
  • Word 97-2003/the-vampire-diaries-season-1-episode-1-worksheet_2.doc 1.5 MB
  • Word 97-2003/the-verb-to-be.doc 31.2 kB
  • Word 97-2003/the-wanted-glad-you-came.doc 215.0 kB
  • Word 97-2003/the-wanted.doc 21.0 kB
  • Word 97-2003/the-weather-for-kids.doc 188.9 kB
  • Word 97-2003/the-weather.doc 280.1 kB
  • Word 97-2003/the-wolf-and-the-lamb.doc 131.1 kB
  • Word 97-2003/the-wonder-ears.doc 31.7 kB
  • Word 97-2003/the-world-of-art-9-form.doc 1.3 MB
  • Word 97-2003/the-world-of-comics-busy-teacher.doc 1.0 MB
  • Word 97-2003/the-world-of-the-cinema.doc 101.4 kB
  • Word 97-2003/the.doc 469.0 kB
  • Word 97-2003/the_awful_fate_of_melpomenus_jones_1.doc 44.5 kB
  • Word 97-2003/the_awful_fate_of_melpomenus_jones_1_001.doc 44.5 kB
  • Word 97-2003/the_landlady_part_1.doc 54.8 kB
  • Word 97-2003/the_landlady_part_1_001.doc 54.8 kB
  • Word 97-2003/the_landlady_part_3.doc 39.4 kB
  • Word 97-2003/the_landlady_part_3_001.doc 39.4 kB
  • Word 97-2003/the_landladypart_2.doc 923.6 kB
  • Word 97-2003/the_landladypart_2_001.doc 923.6 kB
  • Word 97-2003/the_lefthanders.doc 30.7 kB
  • Word 97-2003/the_lefthanders_001.doc 30.7 kB
  • Word 97-2003/the_man_who_sold_the_eiffel_tower.doc 31.2 kB
  • Word 97-2003/the_man_who_sold_the_eiffel_tower_001.doc 31.2 kB
  • Word 97-2003/the_passive_voice.doc 48.1 kB
  • Word 97-2003/the_pirate_song.doc 36.9 kB
  • Word 97-2003/the_pirate_song_001.doc 36.9 kB
  • Word 97-2003/there-are-monkeys.doc 211.5 kB
  • Word 97-2003/there-are-some-eggs-in-the-fridge.doc 180.2 kB
  • Word 97-2003/there-are-some-toys-in-the-bedroom.doc 222.2 kB
  • Word 97-2003/there-are-some-toys-in-the-bedroom_001.doc 119.8 kB
  • Word 97-2003/there-are.doc 106.0 kB
  • Word 97-2003/there-is-and-there-are.doc 62.0 kB
  • Word 97-2003/there-is-place-prepositions.doc 487.4 kB
  • Word 97-2003/there-is-there-are-2011.doc 111.6 kB
  • Word 97-2003/there-is-there-are-2011_001.doc 115.7 kB
  • Word 97-2003/there-is-there-are.doc 55.8 kB
  • Word 97-2003/there-is-there-are_001.doc 1.7 MB
  • Word 97-2003/there-is-there-are_002.doc 49.2 kB
  • Word 97-2003/there-is.doc 243.7 kB
  • Word 97-2003/there-to-be.doc 118.8 kB
  • Word 97-2003/there-was-a-murder-in-the-usa.doc 59.4 kB
  • Word 97-2003/there-was-and-there-were.doc 9.6 MB
  • Word 97-2003/there-was-and-there-were_001.doc 9.6 MB
  • Word 97-2003/there-was-there-were.doc 398.3 kB
  • Word 97-2003/there_is_are.doc 25.6 kB
  • Word 97-2003/There_is_there_are.doc 1.4 MB
  • Word 97-2003/there_isare_say-and-draw_lesson_plan.doc 444.9 kB
  • Word 97-2003/thereis4kids.doc 91.6 kB
  • Word 97-2003/thereisare.doc 51.2 kB
  • Word 97-2003/thereisare_001.doc 51.2 kB
  • Word 97-2003/theres-a-book-on-the-bed.doc 252.9 kB
  • Word 97-2003/theres_therere-furniture_rooms.doc 108.5 kB
  • Word 97-2003/thesaurus.doc 26.6 kB
  • Word 97-2003/they-dont-get-up-late.doc 273.9 kB
  • Word 97-2003/they-have-got-a-lot-of-toys.doc 286.2 kB
  • Word 97-2003/things-ill-never-say-1.doc 77.3 kB
  • Word 97-2003/things-in-the-bathroom.doc 465.4 kB
  • Word 97-2003/things-in-the-kitchen-multiple-choice.doc 460.8 kB
  • Word 97-2003/things_are_not_always_what_they_seem.doc 30.7 kB
  • Word 97-2003/things_are_not_always_what_they_seem_001.doc 30.7 kB
  • Word 97-2003/third-conditional-bdgame.doc 94.2 kB
  • Word 97-2003/third-conditional-material.doc 562.2 kB
  • Word 97-2003/third-conditional-sentence-completion-game.doc 22.0 kB
  • Word 97-2003/third-conditional.doc 33.3 kB
  • Word 97-2003/third-conditional_001.doc 60.9 kB
  • Word 97-2003/third-conditional_002.doc 192.5 kB
  • Word 97-2003/third-term-english-exam-for-ms3.doc 190.0 kB
  • Word 97-2003/this-humorous-episode-happened-when-i-was-staying.doc 24.1 kB
  • Word 97-2003/this-is-my-granny.doc 125.4 kB
  • Word 97-2003/this-pretty-face-amy-macdonald.doc 34.3 kB
  • Word 97-2003/thisthese.doc 289.3 kB
  • Word 97-2003/three-little-birds.doc 78.8 kB
  • Word 97-2003/three-test-for-esp-students.doc 60.9 kB
  • Word 97-2003/threebrownbears.doc 261.1 kB
  • Word 97-2003/tick-the-box-if-the-sentence-is-correct.doc 44.5 kB
  • Word 97-2003/tick-the-correct-name-each-animal.doc 493.1 kB
  • Word 97-2003/till-there-was-you-the-beatles.doc 11.3 kB
  • Word 97-2003/time-1.doc 245.8 kB
  • Word 97-2003/time-idioms-worksheet.doc 77.8 kB
  • Word 97-2003/time-of-your-life.doc 43.5 kB
  • Word 97-2003/time-prepositions.doc 324.6 kB
  • Word 97-2003/time.doc 27.1 kB
  • Word 97-2003/time_001.doc 59.4 kB
  • Word 97-2003/time_place.doc 148.5 kB
  • Word 97-2003/tinos.doc 127.0 kB
  • Word 97-2003/tips-for-improving-writing.doc 34.8 kB
  • Word 97-2003/titanic-do-you-know-the-true-facts-of-the-titanic.doc 300.0 kB
  • Word 97-2003/titanic-movie-quiz-with-answers.doc 579.1 kB
  • Word 97-2003/titanic.doc 180.7 kB
  • Word 97-2003/tito-nieves-lyrics.doc 25.1 kB
  • Word 97-2003/tn1-mid-1.doc 43.5 kB
  • Word 97-2003/tn3.doc 29.2 kB
  • Word 97-2003/to-be-1.doc 28.7 kB
  • Word 97-2003/to-be-2013.doc 339.5 kB
  • Word 97-2003/to-be-22.doc 196.6 kB
  • Word 97-2003/to-be-affirmative-and-negative.doc 223.7 kB
  • Word 97-2003/to-be-affirmative.doc 361.5 kB
  • Word 97-2003/to-be-affirmative_001.doc 362.0 kB
  • Word 97-2003/to-be-all-forms.doc 415.2 kB
  • Word 97-2003/to-be-and-have-got.doc 160.8 kB
  • Word 97-2003/to-be-colours.doc 26.1 kB
  • Word 97-2003/to-be-have-got-review-key.doc 195.1 kB
  • Word 97-2003/to-be-have-got.doc 98.3 kB
  • Word 97-2003/to-be-in-past-simple.doc 198.7 kB
  • Word 97-2003/to-be-or-have-got.doc 447.5 kB
  • Word 97-2003/to-be-past-2011.doc 151.0 kB
  • Word 97-2003/to-be-revison.doc 62.0 kB
  • Word 97-2003/to-be-worksheet.doc 134.1 kB
  • Word 97-2003/to-be.doc 26.1 kB
  • Word 97-2003/to-be_001.doc 27.6 kB
  • Word 97-2003/to-be_002.doc 539.1 kB
  • Word 97-2003/to-be_003.doc 57.3 kB
  • Word 97-2003/to-be_am-is-are.doc 413.2 kB
  • Word 97-2003/to-be_am-is-are_001.doc 413.7 kB
  • Word 97-2003/to-fall.doc 100.4 kB
  • Word 97-2003/to-have-got.doc 666.6 kB
  • Word 97-2003/to-watch-tv.doc 600.1 kB
  • Word 97-2003/to_be_6r.doc 25.1 kB
  • Word 97-2003/toast.doc 382.5 kB
  • Word 97-2003/tobeqa.doc 29.2 kB
  • Word 97-2003/tokio-hotel-monsoon.doc 36.9 kB
  • Word 97-2003/toms-diner-gap.doc 25.1 kB
  • Word 97-2003/tongue-twisters.doc 124.4 kB
  • Word 97-2003/tongue-twisters_001.doc 28.7 kB
  • Word 97-2003/tongue-twisters_002.doc 105.0 kB
  • Word 97-2003/tongue_twister.doc 21.0 kB
  • Word 97-2003/too-and-enough_lesson.doc 67.6 kB
  • Word 97-2003/tools-pictionary_full-page.doc 161.8 kB
  • Word 97-2003/tools-pictionary_half-page.doc 161.3 kB
  • Word 97-2003/tools-ws.doc 154.1 kB
  • Word 97-2003/top-gear-comparson.doc 1.8 MB
  • Word 97-2003/top-gear.doc 381.4 kB
  • Word 97-2003/top-word-why.doc 450.6 kB
  • Word 97-2003/topics-to-discuss.doc 26.6 kB
  • Word 97-2003/tori-amos-winter.doc 113.7 kB
  • Word 97-2003/tourist-spots-in-ukraine_gapped.doc 22.5 kB
  • Word 97-2003/toys-3.doc 133.6 kB
  • Word 97-2003/toys-and-games.doc 631.3 kB
  • Word 97-2003/toys-worksheets.doc 480.8 kB
  • Word 97-2003/toys.doc 516.6 kB
  • Word 97-2003/toys_001.doc 489.0 kB
  • Word 97-2003/trace-1.doc 1.8 MB
  • Word 97-2003/trace-and-color-3.doc 340.0 kB
  • Word 97-2003/traffic-offences-worksheet.doc 29.7 kB
  • Word 97-2003/transformation.doc 48.1 kB
  • Word 97-2003/transport.doc 163.3 kB
  • Word 97-2003/transports.doc 290.3 kB
  • Word 97-2003/travel-conversation-questions.doc 21.5 kB
  • Word 97-2003/travel-conversation-questions_001.doc 24.6 kB
  • Word 97-2003/travel-questions.doc 26.6 kB
  • Word 97-2003/travelling-quotes.doc 24.6 kB
  • Word 97-2003/travelling.doc 351.7 kB
  • Word 97-2003/travelling_001.doc 3.1 MB
  • Word 97-2003/treetops-shopping-oxford-market.doc 487.9 kB
  • Word 97-2003/trial-test.doc 38.9 kB
  • Word 97-2003/true-colours.doc 250.4 kB
  • Word 97-2003/true-false.doc 262.1 kB
  • Word 97-2003/tt.doc 27.6 kB
  • Word 97-2003/tt_001.doc 27.6 kB
  • Word 97-2003/tthe-order-of-adgectives.doc 109.1 kB
  • Word 97-2003/tttttttccccccc-janvier.doc 108.0 kB
  • Word 97-2003/tv-advantages-and-disadvantages.doc 32.8 kB
  • Word 97-2003/tv-programmes.doc 525.8 kB
  • Word 97-2003/tv-survey.doc 43.5 kB
  • Word 97-2003/twas-the-night-before-christmas-wsh.doc 314.4 kB
  • Word 97-2003/twilight.doc 96.3 kB
  • Word 97-2003/two-and-a-half-men-ld.doc 47.1 kB
  • Word 97-2003/two-word-compound-words-v-ing-noun-sent.doc 469.0 kB
  • Word 97-2003/types-of-films.doc 257.0 kB
  • Word 97-2003/types-of-music.doc 196.1 kB
  • Word 97-2003/types-of-questions.doc 57.3 kB
  • Word 97-2003/types-of-the-films.doc 860.2 kB
  • Word 97-2003/typical-day.doc 93.2 kB
  • Word 97-2003/u-smile.doc 299.0 kB
  • Word 97-2003/u2-song-activity.doc 210.9 kB
  • Word 97-2003/u2-song-worksheet.doc 37.4 kB
  • Word 97-2003/uk-political-system.doc 42.5 kB
  • Word 97-2003/UK.doc 97.3 kB
  • Word 97-2003/ultimate-survival-discussion.doc 166.4 kB
  • Word 97-2003/ultimate-survival-discussion1.doc 959.5 kB
  • Word 97-2003/umbrella-guide.doc 108.0 kB
  • Word 97-2003/uncountable-countablecountable-nouns.doc 21.5 kB
  • Word 97-2003/unicef-shakira.doc 70.1 kB
  • Word 97-2003/unit-1-bon-jovi-ugly.doc 29.2 kB
  • Word 97-2003/unit-1-comparative-worksheet.doc 1.4 MB
  • Word 97-2003/unit-10-movies-copy.doc 33.8 kB
  • Word 97-2003/unit-11puzzle.doc 42.5 kB
  • Word 97-2003/unit-15-speaking.doc 1.9 MB
  • Word 97-2003/unit-1c.doc 117.8 kB
  • Word 97-2003/unit-2-adjectives-adverbs-1.doc 69.1 kB
  • Word 97-2003/unit-2-corinne-bailey-rae-put-your-records-on.doc 887.8 kB
  • Word 97-2003/unit-3-reflexive-pronouns-2.doc 169.0 kB
  • Word 97-2003/unit-5-stress.doc 707.6 kB
  • Word 97-2003/unit-iv_l-4_worksheets_3rd-f.doc 98.8 kB
  • Word 97-2003/unit5-whos-the-tallest.doc 30.2 kB
  • Word 97-2003/unscramble-the-food-items-and-write-them-into-the.doc 29.2 kB
  • Word 97-2003/unscramble.doc 31.7 kB
  • Word 97-2003/up.doc 423.4 kB
  • Word 97-2003/up_001.doc 28.7 kB
  • Word 97-2003/up_002.doc 31.2 kB
  • Word 97-2003/upload-1.doc 66.0 kB
  • Word 97-2003/upper-shopping.doc 213.0 kB
  • Word 97-2003/upr-s-ris.doc 1.3 MB
  • Word 97-2003/uprising-by-muse-key.doc 92.7 kB
  • Word 97-2003/uprising-by-muse.doc 92.7 kB
  • Word 97-2003/us-government.doc 51.7 kB
  • Word 97-2003/us-warning-over-risk-of-cyber-attacks.doc 55.8 kB
  • Word 97-2003/use-of-english-may.doc 44.5 kB
  • Word 97-2003/use-the-gerund.doc 286.7 kB
  • Word 97-2003/use-your-head-part-1-and-2.doc 336.4 kB
  • Word 97-2003/used-to-chris-daughtry.doc 21.0 kB
  • Word 97-2003/used-to-song.doc 31.2 kB
  • Word 97-2003/used-to.doc 30.2 kB
  • Word 97-2003/used-to_001.doc 133.1 kB
  • Word 97-2003/used-to_002.doc 129.0 kB
  • Word 97-2003/used_to.doc 27.1 kB
  • Word 97-2003/useful-words-to-describe-the-words-you-do-not-know.doc 24.1 kB
  • Word 97-2003/using-trube.doc 20.0 kB
  • Word 97-2003/utensils-exercise.doc 67.6 kB
  • Word 97-2003/valentine-poem.doc 65.5 kB
  • Word 97-2003/valentines-day-2-text-and-activities.doc 517.6 kB
  • Word 97-2003/valentines-day-quotes-game.doc 141.8 kB
  • Word 97-2003/valentines-day.doc 497.7 kB
  • Word 97-2003/valentines-maze.doc 365.1 kB
  • Word 97-2003/vegetables-photo-flashcards.doc 1.2 MB
  • Word 97-2003/vegetables.doc 91.1 kB
  • Word 97-2003/verb-be-2.doc 159.2 kB
  • Word 97-2003/verb-forms-following-wish.doc 29.2 kB
  • Word 97-2003/verb-patterns.doc 12.3 kB
  • Word 97-2003/verb-tenses-review.doc 26.6 kB
  • Word 97-2003/verb-tenses.doc 38.9 kB
  • Word 97-2003/verb-tenses_001.doc 771.6 kB
  • Word 97-2003/verb-tenses_test.doc 66.0 kB
  • Word 97-2003/verb-to-be-present.doc 137.7 kB
  • Word 97-2003/verb-to-be-review.doc 260.6 kB
  • Word 97-2003/verb-to-be-simple-past.doc 115.7 kB
  • Word 97-2003/verb-to-be-test.doc 70.1 kB
  • Word 97-2003/verb-to-be.doc 58.9 kB
  • Word 97-2003/verb-to-be_001.doc 386.6 kB
  • Word 97-2003/verb-to-be_002.doc 194.6 kB
  • Word 97-2003/verb-to-be_003.doc 243.7 kB
  • Word 97-2003/verb-to-be_004.doc 232.4 kB
  • Word 97-2003/verb-to-be_005.doc 122.4 kB
  • Word 97-2003/verb-to-be_006.doc 157.2 kB
  • Word 97-2003/verb__subject__noun.doc 94.7 kB
  • Word 97-2003/verb_object.doc 31.7 kB
  • Word 97-2003/verb_to_be.doc 333.3 kB
  • Word 97-2003/verb_to_be_001.doc 333.3 kB
  • Word 97-2003/verb_to_be__questions__memory_game.doc 29.7 kB
  • Word 97-2003/verb_to_be__questions__memory_game_001.doc 29.7 kB
  • Word 97-2003/verbal-idioms.doc 39.4 kB
  • Word 97-2003/verbos-seguidos-de-infinitivo-o-gerundio.doc 45.6 kB
  • Word 97-2003/verbs-and-adjectives.doc 312.8 kB
  • Word 97-2003/verbs-of-gerund-and-infinitive.doc 214.0 kB
  • Word 97-2003/verbs-word-search-2.doc 533.5 kB
  • Word 97-2003/verbs.doc 119.8 kB
  • Word 97-2003/video-1-the-sword-in-the-stone.doc 47.6 kB
  • Word 97-2003/video-2-shrek-rumpelstiltskin.doc 156.2 kB
  • Word 97-2003/video-activity-mr.doc 95.2 kB
  • Word 97-2003/video-activity.doc 156.2 kB
  • Word 97-2003/video-lesson-mr-bean-appointment-with-the-dentist.doc 62.0 kB
  • Word 97-2003/video-lesson-spanglish.doc 154.1 kB
  • Word 97-2003/video-session-friends-the-one-where-they-all-turn.doc 875.5 kB
  • Word 97-2003/video-session-friends-unagi-6tempdisc3.doc 473.1 kB
  • Word 97-2003/video-session-rise-of-the-planet-of-the-apes.doc 470.0 kB
  • Word 97-2003/video-session-robin-hood-men-in-tights.doc 150.5 kB
  • Word 97-2003/video-session-supernatural-worksheet.doc 41.5 kB
  • Word 97-2003/video-wallace-gromit.doc 239.6 kB
  • Word 97-2003/video-worksheet-mickey-and-minnies-gift-of-the.doc 845.8 kB
  • Word 97-2003/vincent-van-gogh.doc 44.0 kB
  • Word 97-2003/vitamins.doc 24.1 kB
  • Word 97-2003/viva-la-vida-coldplay.doc 46.6 kB
  • Word 97-2003/voc.doc 48.1 kB
  • Word 97-2003/voc_givingdirections_shops.doc 45.6 kB
  • Word 97-2003/vocab-ec-club-msw.doc 169.0 kB
  • Word 97-2003/vocab_shakeitoff.doc 78.3 kB
  • Word 97-2003/vocabaire-pour-pair-work.doc 452.6 kB
  • Word 97-2003/vocabcardseslkorean.doc 80.9 kB
  • Word 97-2003/vocabopposites.doc 32.3 kB
  • Word 97-2003/vocabulary-cards-flyers.doc 85.0 kB
  • Word 97-2003/vocabulary-chart.doc 511.0 kB
  • Word 97-2003/vocabulary-developement.doc 25.6 kB
  • Word 97-2003/vocabulary-food.doc 5.5 MB
  • Word 97-2003/vocabulary-months.doc 42.5 kB
  • Word 97-2003/vocabulary-training.doc 40.4 kB
  • Word 97-2003/vocabulary-valentines-crossword.doc 183.3 kB
  • Word 97-2003/vocabulary-valentines-day.doc 170.5 kB
  • Word 97-2003/vocabulary.doc 105.0 kB
  • Word 97-2003/volcano-vs-earthquake.doc 67.1 kB
  • Word 97-2003/vowels-and-labeling.doc 450.6 kB
  • Word 97-2003/vowels.doc 45.1 kB
  • Word 97-2003/vuvuzelas.doc 26.6 kB
  • Word 97-2003/wahts-the-weather-like.doc 192.5 kB
  • Word 97-2003/waka-waka.doc 33.3 kB
  • Word 97-2003/wake-up-america-miley-cyrus-eslpcontrib.doc 204.8 kB
  • Word 97-2003/wallflowers.doc 34.8 kB
  • Word 97-2003/wanna-gonna-7-informal-contractions.doc 44.0 kB
  • Word 97-2003/wanted-poster-filled-in.doc 793.1 kB
  • Word 97-2003/war-lyrics.doc 28.2 kB
  • Word 97-2003/warm-up-e-reading.doc 2.5 MB
  • Word 97-2003/warm-up-tongue-twisters.doc 28.2 kB
  • Word 97-2003/warm-up-used-to.doc 29.7 kB
  • Word 97-2003/warm-up1.doc 2.2 MB
  • Word 97-2003/was-were-2011.doc 334.3 kB
  • Word 97-2003/was-were.doc 76.8 kB
  • Word 97-2003/was_were.doc 522.8 kB
  • Word 97-2003/washroom_story_einsteing_chauffer.doc 42.5 kB
  • Word 97-2003/washroom_story_einsteing_chauffer_001.doc 42.5 kB
  • Word 97-2003/wavin-flag-song-act.doc 127.5 kB
  • Word 97-2003/waving-flag-by-k.doc 29.7 kB
  • Word 97-2003/waving-flag.doc 43.0 kB
  • Word 97-2003/we-are-never-ever-getting-back-together.doc 46.1 kB
  • Word 97-2003/we-are-the-champions.doc 162.8 kB
  • Word 97-2003/we-are-the-champions2.doc 178.7 kB
  • Word 97-2003/we-are-the-championsesl.doc 103.9 kB
  • Word 97-2003/we-areyoung.doc 29.2 kB
  • Word 97-2003/we-bought-a-zoo.doc 2.5 MB
  • Word 97-2003/we-live-in-a-flat.doc 195.1 kB
  • Word 97-2003/we-play-we-go.doc 107.0 kB
  • Word 97-2003/we-the-children-of-class.doc 33.3 kB
  • Word 97-2003/we-use-the-present-simple-for-habits-basic-levels.doc 61.4 kB
  • Word 97-2003/weareyoung2.doc 16.9 kB
  • Word 97-2003/weather-and-clothes.doc 2.4 MB
  • Word 97-2003/weather-board-game.doc 322.6 kB
  • Word 97-2003/weather-idioms-test.doc 439.8 kB
  • Word 97-2003/weather-missing-letters.doc 371.2 kB
  • Word 97-2003/weather-word-scramble.doc 58.9 kB
  • Word 97-2003/weather.doc 263.8 kB
  • Word 97-2003/weather_001.doc 269.8 kB
  • Word 97-2003/weather_002.doc 165.4 kB
  • Word 97-2003/weather_boxes_all.doc 129.1 kB
  • Word 97-2003/weather_photographs.doc 3.3 MB
  • Word 97-2003/weather_rhymes.doc 161.9 kB
  • Word 97-2003/weather_worksheet.doc 140.8 kB
  • Word 97-2003/weatherflashcards.doc 261.1 kB
  • Word 97-2003/web-search-london.doc 32.3 kB
  • Word 97-2003/weblish-worksheet.doc 36.9 kB
  • Word 97-2003/wedding-pictionary.doc 307.7 kB
  • Word 97-2003/week-days.doc 218.1 kB
  • Word 97-2003/week8womansong.doc 198.1 kB
  • Word 97-2003/weird-animal-facts.doc 242.2 kB
  • Word 97-2003/welcome-2-unit-11-dialogue.doc 349.2 kB
  • Word 97-2003/welcome-back-to-school.doc 627.7 kB
  • Word 97-2003/welcome_cards_handymanny.doc 815.1 kB
  • Word 97-2003/west-life-song-my-love-worksheets.doc 265.7 kB
  • Word 97-2003/wh-question-practice.doc 28.7 kB
  • Word 97-2003/wh-questions.doc 166.4 kB
  • Word 97-2003/wh-word.doc 133.1 kB
  • Word 97-2003/wh-word_001.doc 130.6 kB
  • Word 97-2003/what-a-career-coach-is.doc 55.3 kB
  • Word 97-2003/what-a-mess.doc 470.5 kB
  • Word 97-2003/what-a-wonderful-world-by-ramone.doc 471.0 kB
  • Word 97-2003/what-about.doc 140.3 kB
  • Word 97-2003/what-are-the-babies-doing.doc 508.9 kB
  • Word 97-2003/what-are-the-simpsons-doing.doc 68.6 kB
  • Word 97-2003/what-are-the-symptoms.doc 663.0 kB
  • Word 97-2003/what-are-they-doing.doc 647.2 kB
  • Word 97-2003/what-are-they-doing_001.doc 183.3 kB
  • Word 97-2003/what-are-they-doing_002.doc 391.7 kB
  • Word 97-2003/what-are-they-doing_003.doc 183.3 kB
  • Word 97-2003/what-are-they-going-to-do-next-summer.doc 338.9 kB
  • Word 97-2003/what-are-they-like.doc 86.5 kB
  • Word 97-2003/what-are-they.doc 121.9 kB
  • Word 97-2003/what-color-is-your.doc 347.6 kB
  • Word 97-2003/what-di-you-do-for-your-holiday.doc 12.3 kB
  • Word 97-2003/what-did-they-do-yesterday-key.doc 411.1 kB
  • Word 97-2003/what-did-you-do-last.doc 86.0 kB
  • Word 97-2003/what-did-you-do-last_001.doc 86.5 kB
  • Word 97-2003/what-do-they-do-in-their-jobs-1.doc 316.4 kB
  • Word 97-2003/what-do-they-do-in-their-jobs-2.doc 473.1 kB
  • Word 97-2003/what-do-you-do.doc 361.0 kB
  • Word 97-2003/what-do-you-eat-1.doc 281.1 kB
  • Word 97-2003/what-do-you-eat-2.doc 382.5 kB
  • Word 97-2003/what-do-you-eat-3.doc 318.5 kB
  • Word 97-2003/what-do-you-eat-4.doc 376.8 kB
  • Word 97-2003/what-do-you-eat-5-desserts-drinks.doc 502.3 kB
  • Word 97-2003/what-do-you-want-from-me-zagotovka.doc 28.7 kB
  • Word 97-2003/what-have-they-done.doc 507.9 kB
  • Word 97-2003/what-if-if-i-were-you.doc 32.3 kB
  • Word 97-2003/what-if.doc 285.8 kB
  • Word 97-2003/what-is-it-for-dibujos.doc 348.2 kB
  • Word 97-2003/what-is-on-today.doc 35.8 kB
  • Word 97-2003/what-is-there.doc 224.8 kB
  • Word 97-2003/what-question-worksheet.doc 24.6 kB
  • Word 97-2003/what-symptoms.doc 1.1 MB
  • Word 97-2003/what-time-is-it-worksheet.doc 252.4 kB
  • Word 97-2003/what-time-is-it.doc 83.5 kB
  • Word 97-2003/what-time-is-it_001.doc 918.0 kB
  • Word 97-2003/what-went-wrong-on-holiday.doc 474.1 kB
  • Word 97-2003/what-word-do-you-need-to-complete-the-sentence.doc 27.6 kB
  • Word 97-2003/what_animals_do.doc 97.8 kB
  • Word 97-2003/what_are_they_doing.doc 472.6 kB
  • Word 97-2003/what_did_tom_do_yesterday.doc 174.1 kB
  • Word 97-2003/what_did_tom_do_yesterday_001.doc 174.1 kB
  • Word 97-2003/whats-in-your-classroom.doc 504.8 kB
  • Word 97-2003/whats-the-adjective.doc 40.4 kB
  • Word 97-2003/whats-the-hobby.doc 383.0 kB
  • Word 97-2003/whats-the-matter.doc 154.6 kB
  • Word 97-2003/whats-your-reaction-preferences.doc 29.7 kB
  • Word 97-2003/whats-your-reaction-preferences_001.doc 32.8 kB
  • Word 97-2003/whatsthematter.doc 118.3 kB
  • Word 97-2003/wheelstoteachpartsofthebody.doc 201.2 kB
  • Word 97-2003/when-does-jill-do-those-actions.doc 1.2 MB
  • Word 97-2003/when-i-needed-you.doc 20.0 kB
  • Word 97-2003/when-i-was-ten.doc 88.6 kB
  • Word 97-2003/when-while.doc 277.5 kB
  • Word 97-2003/where-and-when-did-halloween-start.doc 33.8 kB
  • Word 97-2003/where-are-they-from-2.doc 304.1 kB
  • Word 97-2003/where-are-they-from-3.doc 128.5 kB
  • Word 97-2003/where-can-you-biy.doc 504.8 kB
  • Word 97-2003/where-do-you-want-to-go.doc 270.3 kB
  • Word 97-2003/where-is-james.doc 32.8 kB
  • Word 97-2003/where-is-the-ball.doc 156.7 kB
  • Word 97-2003/where-is-the-dog.doc 270.8 kB
  • Word 97-2003/where-the-hell-is-matt-busyteacher.doc 48.1 kB
  • Word 97-2003/where-the-wild-things-are.doc 26.6 kB
  • Word 97-2003/while-you-were-sleeping-activities-keys.doc 34.8 kB
  • Word 97-2003/white-christmas.doc 128.0 kB
  • Word 97-2003/white-lie-song-by-zachary-pincus.doc 148.5 kB
  • Word 97-2003/whitney-houston-biography-pairwork.doc 47.1 kB
  • Word 97-2003/who-am-i.doc 19.5 kB
  • Word 97-2003/who-am-i_001.doc 359.4 kB
  • Word 97-2003/who-are-they.doc 820.7 kB
  • Word 97-2003/who-is-she.doc 539.1 kB
  • Word 97-2003/who-is-who.doc 273.4 kB
  • Word 97-2003/who-lives-where.doc 140.8 kB
  • Word 97-2003/who_where_when_why_what-questions_ana.doc 482.8 kB
  • Word 97-2003/whose-activitiy1.doc 494.6 kB
  • Word 97-2003/whose-backpack-is-this-genitive-case.doc 1.2 MB
  • Word 97-2003/whose-bicycle-is-this.doc 284.7 kB
  • Word 97-2003/why-are-you-staring-at-me.doc 185.9 kB
  • Word 97-2003/why-learn-a-foreign-language.doc 73.2 kB
  • Word 97-2003/why-you-are-not-getting-a-promotion.doc 52.2 kB
  • Word 97-2003/why_is_the_cartoon_above_funny_used_to.doc 41.0 kB
  • Word 97-2003/why_is_the_cartoon_above_funny_used_to_001.doc 41.0 kB
  • Word 97-2003/wicked-game.doc 32.3 kB
  • Word 97-2003/wiki-introduction.doc 352.8 kB
  • Word 97-2003/wild-animals.doc 278.5 kB
  • Word 97-2003/wild.doc 399.9 kB
  • Word 97-2003/wild_things.doc 484.9 kB
  • Word 97-2003/wild_things_001.doc 484.9 kB
  • Word 97-2003/will-for-predictions-based-on-an-episode-of.doc 33.3 kB
  • Word 97-2003/willgoing-to-present-continuous.doc 64.5 kB
  • Word 97-2003/windows-down-big-time-rush.doc 36.4 kB
  • Word 97-2003/winnie-the-pooh-halloween.doc 187.9 kB
  • Word 97-2003/winnie.doc 502.8 kB
  • Word 97-2003/winter-vocabulary.doc 211.5 kB
  • Word 97-2003/winter.doc 522.8 kB
  • Word 97-2003/wishes.doc 282.6 kB
  • Word 97-2003/within-temptation-bittersweet-warm-up.doc 30.7 kB
  • Word 97-2003/without-you-worksheet.doc 54.3 kB
  • Word 97-2003/without-you.doc 31.7 kB
  • Word 97-2003/woman-drops-cat-in-bin-with-added-relative-clauses.doc 37.4 kB
  • Word 97-2003/women-in-business.doc 1.2 MB
  • Word 97-2003/wonderful-tonight.doc 168.4 kB
  • Word 97-2003/wonderful-world-artist-sam-cooke.doc 30.2 kB
  • Word 97-2003/wont-go-home-without-you.doc 231.4 kB
  • Word 97-2003/word-building-a.doc 40.4 kB
  • Word 97-2003/word-formation-1st-high.doc 58.9 kB
  • Word 97-2003/word-formation-adj-to-n-v.doc 76.3 kB
  • Word 97-2003/word-formation-adj-to-n-v_001.doc 74.2 kB
  • Word 97-2003/word-formation-esl-1.doc 102.9 kB
  • Word 97-2003/word-formation-noun-v-adj.doc 79.4 kB
  • Word 97-2003/word-formation-noun-v-adj_001.doc 78.8 kB
  • Word 97-2003/word-formation-verb-n-adj.doc 70.1 kB
  • Word 97-2003/word-formation-verb-n-adj_001.doc 67.1 kB
  • Word 97-2003/word-formation.doc 89.6 kB
  • Word 97-2003/word-formation_001.doc 31.2 kB
  • Word 97-2003/word-formation_002.doc 214.0 kB
  • Word 97-2003/word-formation_003.doc 201.2 kB
  • Word 97-2003/word-formation_004.doc 89.1 kB
  • Word 97-2003/word-order-subjects.doc 28.2 kB
  • Word 97-2003/word-order-verb-tenses-personal-pronouns-questions.doc 482.8 kB
  • Word 97-2003/word-search.doc 73.7 kB
  • Word 97-2003/word-stress.doc 41.0 kB
  • Word 97-2003/wordonthestreet-poverty-and-homelessness-in-the.doc 56.8 kB
  • Word 97-2003/words-beginning-with-t.doc 450.0 kB
  • Word 97-2003/words-containing.doc 21.0 kB
  • Word 97-2003/words-for-manners-bingo.doc 51.7 kB
  • Word 97-2003/words-that-end-in-gry.doc 31.7 kB
  • Word 97-2003/words-to-describe-sound.doc 131.1 kB
  • Word 97-2003/words.doc 51.2 kB
  • Word 97-2003/wordsearch-review-calendar-and-greetings.doc 127.0 kB
  • Word 97-2003/work.doc 81.4 kB
  • Word 97-2003/workbookexpressions.doc 409.6 kB
  • Word 97-2003/working-in-pairs.doc 57.9 kB
  • Word 97-2003/worksheet-1.doc 193.5 kB
  • Word 97-2003/worksheet-1someany2.doc 118.8 kB
  • Word 97-2003/worksheet-circle-the-animals-that-live-in-the-sea.doc 1.1 MB
  • Word 97-2003/worksheet-lesson-2.doc 645.6 kB
  • Word 97-2003/worksheet-n1-1.doc 26.6 kB
  • Word 97-2003/worksheet-of-adverb.doc 436.7 kB
  • Word 97-2003/worksheet-on-describing-words-for-busyteacher.doc 219.6 kB
  • Word 97-2003/worksheet-present-continuous.doc 213.5 kB
  • Word 97-2003/worksheet-present-simple.doc 131.6 kB
  • Word 97-2003/worksheet-review-prepositions-_-simple-present.doc 27.6 kB
  • Word 97-2003/worksheet-the-family.doc 40.4 kB
  • Word 97-2003/worksheet-the-joneses.doc 484.9 kB
  • Word 97-2003/worksheet-times-of-the-day.doc 671.2 kB
  • Word 97-2003/worksheet.doc 44.0 kB
  • Word 97-2003/worksheet1.doc 52.2 kB
  • Word 97-2003/worksheet_-sports-and-hobbies.doc 386.6 kB
  • Word 97-2003/worksheet_001.doc 266.8 kB
  • Word 97-2003/worksheet_002.doc 293.4 kB
  • Word 97-2003/worksheet_003.doc 396.8 kB
  • Word 97-2003/worksheet_004.doc 339.5 kB
  • Word 97-2003/worksheetphrasal-verbs.doc 59.4 kB
  • Word 97-2003/worksheets-comparatives.doc 670.2 kB
  • Word 97-2003/workshop_engineering_slowniczek.doc 178.2 kB
  • Word 97-2003/workshop_travel_and_catering_slowniczek.doc 171.5 kB
  • Word 97-2003/write-about-these-animals.doc 267.8 kB
  • Word 97-2003/write-sentences-about-this-family.doc 2.4 MB
  • Word 97-2003/write-the-correct-preposition.doc 70.7 kB
  • Word 97-2003/writing-a-postcard.doc 3.2 MB
  • Word 97-2003/writing-lesson-plans.doc 97.8 kB
  • Word 97-2003/writing-marking-symbols-poster.doc 25.6 kB
  • Word 97-2003/writing-skills.doc 24.6 kB
  • Word 97-2003/writing.doc 36.9 kB
  • Word 97-2003/writing_001.doc 24.6 kB
  • Word 97-2003/writinghorrorstories.doc 162.3 kB
  • Word 97-2003/wstaw-form-przesz-odpowiedni-do-zda.doc 20.0 kB
  • Word 97-2003/yellow-spotted-lizards-reading.doc 25.1 kB
  • Word 97-2003/yellow-submarine-the-beatles.doc 22.5 kB
  • Word 97-2003/yellow-submarine.doc 26.1 kB
  • Word 97-2003/yellow-submarine_001.doc 37.9 kB
  • Word 97-2003/yeni-microsoft-word-document.doc 58.9 kB
  • Word 97-2003/yesterday_fill_in_the_gaps_task.doc 45.6 kB
  • Word 97-2003/yo-yee-school-subjects.doc 490.0 kB
  • Word 97-2003/yo-yee-shapes.doc 96.8 kB
  • Word 97-2003/you-gave-the-strenght-to-me.doc 36.9 kB
  • Word 97-2003/you-should-eat-much.doc 235.5 kB
  • Word 97-2003/you-should-see-a-doctor.doc 1.0 MB
  • Word 97-2003/young-folks-by-the-kooks.doc 292.4 kB
  • Word 97-2003/young-frankenstein-worksheet.doc 165.9 kB
  • Word 97-2003/young-the-giant-cough-syrup-1.doc 453.6 kB
  • Word 97-2003/your-time-will-come-amy-macdonald.doc 30.7 kB
  • Word 97-2003/youre-annoyed.doc 28.7 kB
  • Word 97-2003/youre-my-best-friend.doc 182.8 kB
  • Word 97-2003/youre-my-everything.doc 27.1 kB
  • Word 97-2003/youve-got-a-friend.doc 22.0 kB
  • Word 97-2003/youve-got-a-friend_001.doc 28.2 kB
  • Word 97-2003/zadaniasic.doc 38.9 kB
  • Word 97-2003/zaimki-osobowe-i-przymiotniki.doc 233.0 kB
  • Word 97-2003/zaproszenia.doc 45.6 kB
  • Word 97-2003/zero-first-second-conditional.doc 29.2 kB
  • Word 97-2003/zoe.doc 52.2 kB
  • Word 97-2003/ZOE_001.doc 52.2 kB
  • Word 97-2003/zoo-animals.doc 1.1 MB
  • Word 97-2003/zoo-animlas.doc 110.6 kB
  • Word 97-2003/zorro-alphabet-abc.doc 493.6 kB
  • Word 97-2003/zorro-alphabet-def.doc 243.7 kB
  • Word 97-2003/zorro-alphabet-ghi.doc 384.0 kB
  • Word 97-2003/zorro-alphabet-jkl.doc 495.1 kB
  • Word 97-2003/zorro-alphabet-mno.doc 1.0 MB
  • Word 97-2003/zorro-alphabet-pqr.doc 342.5 kB
  • Word/08b.docx 14.3 kB
  • Word/1-first-conditional-part-one-presentation-and.docx 33.4 kB
  • Word/1-harry-potter-and-the-sorcerers-stone.docx 66.7 kB
  • Word/1-net.docx 304.3 kB
  • Word/1-ni241os-mid-year-test-institute.docx 1.3 MB
  • Word/1.docx 140.4 kB
  • Word/10-great-healthy-habits-for-a-healthy-new-you.docx 37.7 kB
  • Word/10th-grade-first-term-evaluation.docx 1.8 MB
  • Word/1186bach-reported-speech.docx 18.3 kB
  • Word/11th-english.docx 30.3 kB
  • Word/19.docx 248.6 kB
  • Word/1_001.docx 183.8 kB
  • Word/1_002.docx 13.2 kB
  • Word/1_003.docx 35.5 kB
  • Word/1_004.docx 11.6 kB
  • Word/1st-conditional.docx 14.9 kB
  • Word/2.docx 14.7 kB
  • Word/2012-modal-verb-practice.docx 60.0 kB
  • Word/2_001.docx 144.2 kB
  • Word/2_002.docx 146.8 kB
  • Word/2_003.docx 146.8 kB
  • Word/2b-u12-just-the-way-you-are.docx 371.2 kB
  • Word/2nd-conditional-cards.docx 13.3 kB
  • Word/2nd-years-corpse-bride.docx 68.5 kB
  • Word/3-the-first-conditional-interrogatives.docx 17.9 kB
  • Word/3.docx 16.8 kB
  • Word/305rregular-puzzle.docx 19.4 kB
  • Word/3232me-lettres-3232me-trimestre.docx 43.2 kB
  • Word/3_001.docx 17.6 kB
  • Word/3d-shape.docx 526.6 kB
  • Word/3letterfrequentwords.docx 12.8 kB
  • Word/3rd-form-group-work.docx 135.0 kB
  • Word/4-rooms.docx 11.7 kB
  • Word/4-tipa-sloga.docx 14.6 kB
  • Word/4tenses.docx 18.9 kB
  • Word/500-days-of-summer_movie-worksheet.docx 2.4 MB
  • Word/50firstdates-movieworksheet.docx 511.3 kB
  • Word/6bas_ingles_-retroalimentacion_15-06.docx 1.7 MB
  • Word/7-things.docx 55.9 kB
  • Word/7th-form-diagnostic-test.docx 269.7 kB
  • Word/8-food.docx 221.9 kB
  • Word/8-verb-tenses.docx 51.5 kB
  • Word/8.docx 12.8 kB
  • Word/913-923933922917921927.docx 379.7 kB
  • Word/a-brief-history-of-tourism.docx 272.6 kB
  • Word/a-chefs-life.docx 59.5 kB
  • Word/a-christmas-carol-questions.docx 13.7 kB
  • Word/a-diary-of-justin-beiber_teaching-notes.docx 1.1 MB
  • Word/a-farmer.docx 45.0 kB
  • Word/a-hard-daynight.docx 154.3 kB
  • Word/a-large-area-of-your-country-has-been-set-aside.docx 12.6 kB
  • Word/a-little-time-tag-questions.docx 12.3 kB
  • Word/a-movie-synopsis-level-5.docx 2.5 MB
  • Word/a-or-an.docx 440.1 kB
  • Word/a-pizza.docx 143.2 kB
  • Word/a-recipe-omelette.docx 121.0 kB
  • Word/a-scary-story.docx 100.2 kB
  • Word/a-scary-story_001.docx 100.2 kB
  • Word/a-strange-meal.docx 30.6 kB
  • Word/a-surgeon-againreading.docx 15.6 kB
  • Word/a-violinist-in-the-metro.docx 12.6 kB
  • Word/a-wonderful-day.docx 245.4 kB
  • Word/a.docx 22.0 kB
  • Word/A_Brief_History_of_Tourism.docx 271.2 kB
  • Word/a_class_based_on_obamas_speech.docx 66.3 kB
  • Word/abc-restaurant.docx 197.7 kB
  • Word/acceptable-public-conduct-in-germany-naus.docx 15.0 kB
  • Word/access-3vocabulary-practice-unit-7.docx 102.0 kB
  • Word/ace-of-base.docx 651.4 kB
  • Word/action-verbs.docx 2.7 MB
  • Word/actions-for-continuous-tense-practice.docx 11.0 kB
  • Word/active-and-passive-.docx 17.7 kB
  • Word/actividad-final-arnold.docx 222.7 kB
  • Word/actividad-final-arnold_001.docx 222.7 kB
  • Word/activiety-questions.docx 13.9 kB
  • Word/activities-booklet..docx 1.7 MB
  • Word/activity-1-present-continuous.docx 103.6 kB
  • Word/activity-for-connie-talbot-over-the-rainbow.docx 45.1 kB
  • Word/activity-movie.docx 66.0 kB
  • Word/adding-sion.docx 15.9 kB
  • Word/adele-rolling-in-the-deep.docx 109.2 kB
  • Word/adele-rolling-in-the-deep_001.docx 26.5 kB
  • Word/adele-someone-like-u.docx 15.1 kB
  • Word/adele.docx 13.0 kB
  • Word/adele_001.docx 36.4 kB
  • Word/adjective-formation.docx 220.3 kB
  • Word/adjective-iii.docx 102.5 kB
  • Word/adjective-preposition.docx 122.1 kB
  • Word/adjective-preposition_001.docx 272.2 kB
  • Word/adjective-vs-adverb.docx 15.7 kB
  • Word/adjective-vs-adverb_001.docx 15.7 kB
  • Word/adjectives-c3.docx 18.9 kB
  • Word/adjectives-degree.docx 144.4 kB
  • Word/adjectives-dominoes.docx 832.0 kB
  • Word/adjectives-ending-in-ed-and-ing.docx 28.0 kB
  • Word/adjectives-of-comparison.docx 17.0 kB
  • Word/adjectives-scramble.docx 13.5 kB
  • Word/adjectives-sentence-structures.docx 12.6 kB
  • Word/adjectives-story.docx 13.1 kB
  • Word/adjectives-story_001.docx 12.6 kB
  • Word/adjectives-story_002.docx 12.6 kB
  • Word/adjectives.docx 308.7 kB
  • Word/adjectives_001.docx 774.4 kB
  • Word/adjectives_002.docx 139.1 kB
  • Word/adjectives_worksheet.docx 17.3 kB
  • Word/adv.docx 21.5 kB
  • Word/advanced-vocabulary-quiz-170-180-words-nameless.docx 24.0 kB
  • Word/advantages-and-disadvantages-of-the-internet.docx 115.2 kB
  • Word/adverb-commands-a.docx 13.8 kB
  • Word/adverb-review.docx 66.9 kB
  • Word/adverbs-easily-confused.docx 57.8 kB
  • Word/adverbs-formation-and-use.docx 346.4 kB
  • Word/adverbs-of-different-meanings.docx 16.1 kB
  • Word/adverbs-of-frequency.docx 398.0 kB
  • Word/adverbs-of-frequency_001.docx 18.5 kB
  • Word/adverbs-of-timeplace-and-degree.docx 83.4 kB
  • Word/adverbs.docx 346.4 kB
  • Word/advice-please-you-should.docx 11.4 kB
  • Word/affixes.docx 19.6 kB
  • Word/agoodoralpresentation.docx 13.8 kB
  • Word/agreeing-present-continous-health-likes-and.docx 40.8 kB
  • Word/air-travel-dominoes.docx 11.2 kB
  • Word/alex-clare.docx 14.0 kB
  • Word/alfabeto.docx 531.5 kB
  • Word/all-about-you.docx 26.3 kB
  • Word/all-along-it-was-a-fever.docx 25.8 kB
  • Word/all-i-want-for-christmas-mariah-carry.docx 62.7 kB
  • Word/all-you-need-to-know-about-kitchen-and-cooking.docx 15.5 kB
  • Word/allaboutme.docx 137.3 kB
  • Word/alphabet-and-colours.docx 842.4 kB
  • Word/alphabet-practice.docx 96.4 kB
  • Word/alphabet.docx 11.3 kB
  • Word/although.docx 185.2 kB
  • Word/am-i-telling-the-truth.docx 10.6 kB
  • Word/american-english-2.docx 153.9 kB
  • Word/american-pie.docx 106.8 kB
  • Word/american-symbols-2.docx 354.2 kB
  • Word/an-emergency.docx 4.6 MB
  • Word/and-god-created-the-dj.docx 62.0 kB
  • Word/animal-expressions.docx 22.6 kB
  • Word/animal-habitats-word-search.docx 276.2 kB
  • Word/animal-instinct-handout.docx 11.1 kB
  • Word/animal-riddles.docx 20.1 kB
  • Word/animalfarm.docx 228.0 kB
  • Word/animals-flashcard.docx 1.2 MB
  • Word/animals-from-the-book-baby-farm-animals.docx 113.0 kB
  • Word/animals-level-2.docx 379.8 kB
  • Word/animals-missing-vowels.docx 507.6 kB
  • Word/animals-wordsearch.docx 501.8 kB
  • Word/animals.docx 876.0 kB
  • Word/animals_001.docx 193.7 kB
  • Word/another-day-in-paradise-by-phill-collins.docx 16.7 kB
  • Word/answer-the-questions.docx 19.5 kB
  • Word/anybody-anything-somebody-something.docx 155.8 kB
  • Word/anzac-initial-task.docx 607.3 kB
  • Word/apostrophe-worksheet.docx 92.6 kB
  • Word/apostrophes.docx 860.4 kB
  • Word/appendix-2.docx 332.4 kB
  • Word/appositive-reviewparticipial-phrases.docx 171.2 kB
  • Word/Appositive_Review_Participial_Phrases.docx 171.3 kB
  • Word/armstrong.docx 14.0 kB
  • Word/around-the-world-dishes.docx 45.8 kB
  • Word/art-worksheet.docx 24.4 kB
  • Word/arthur-christmas.docx 453.0 kB
  • Word/articles-a-an-this-these.docx 59.8 kB
  • Word/articles-tests.docx 21.6 kB
  • Word/articles.docx 159.7 kB
  • Word/articles_001.docx 159.7 kB
  • Word/articles_002.docx 40.2 kB
  • Word/articles_003.docx 45.4 kB
  • Word/ary_ery_ory.docx 51.2 kB
  • Word/as-long-as-you-love-me.docx 12.3 kB
  • Word/ash-maze.docx 19.5 kB
  • Word/asking-questions-in-the-past.docx 184.4 kB
  • Word/aspects-of-character.docx 13.3 kB
  • Word/asterix-in-britain-vol-8-worksheet.docx 3.0 MB
  • Word/at-in-on-time-2011.docx 135.8 kB
  • Word/at-the-beach.docx 655.0 kB
  • Word/at-the-castle.docx 214.4 kB
  • Word/at-the-market.docx 84.7 kB
  • Word/atilla-quiz.docx 22.7 kB
  • Word/attendance-record.docx 32.1 kB
  • Word/attributive-and-predicative-adjectives.docx 147.3 kB
  • Word/australia-worksheet.docx 95.0 kB
  • Word/australia.docx 44.0 kB
  • Word/authentic-texttasks.docx 18.9 kB
  • Word/auxiliary-verbs.docx 45.9 kB
  • Word/avatar-2.docx 162.1 kB
  • Word/avoiding-repetition-adv.docx 16.6 kB
  • Word/avril-lavigne-biography.docx 49.0 kB
  • Word/avril-vs-gaga.docx 76.5 kB
  • Word/awareness-campaigns-and-advertising.docx 16.1 kB
  • Word/babies.docx 611.1 kB
  • Word/baby-animals.docx 60.1 kB
  • Word/back-theory-exercise.docx 38.9 kB
  • Word/back-to-december.docx 35.9 kB
  • Word/back-to-school-activities.docx 18.3 kB
  • Word/balloons-guessing-game-gtky.docx 13.8 kB
  • Word/bang-bang-past-tense.docx 12.3 kB
  • Word/banking-terminology-crossword.docx 27.0 kB
  • Word/banned-puppy-mills-ads.docx 136.5 kB
  • Word/barbie-girl3.docx 13.5 kB
  • Word/barbie-history.docx 1.3 MB
  • Word/bart-simpson.docx 50.4 kB
  • Word/basestrong-adj-barve-copy.docx 259.7 kB
  • Word/basic-english-questions-1.docx 78.4 kB
  • Word/basic-exam-verb-to-be-describe-prepositions.docx 495.6 kB
  • Word/basic-questions.docx 35.7 kB
  • Word/battleship-on-food.docx 233.5 kB
  • Word/be-adverbs-of-frequency-worksheet.docx 16.3 kB
  • Word/be-the-change-docx.docx 151.6 kB
  • Word/beautiful-dawn.docx 52.1 kB
  • Word/bedroom-2011.docx 107.4 kB
  • Word/before.docx 11.7 kB
  • Word/beg-3-present-continuous.docx 48.9 kB
  • Word/ben-hollys.docx 651.0 kB
  • Word/best-meaning.docx 12.1 kB
  • Word/bet-game.docx 12.9 kB
  • Word/bethany-ing-nouns.docx 61.6 kB
  • Word/better-together-by-jack-johnson.docx 462.1 kB
  • Word/beuty-drop-dead-diva.docx 43.4 kB
  • Word/bill-gates-on-life.docx 25.6 kB
  • Word/billy-jean.docx 13.3 kB
  • Word/binder-spines2.docx 1.6 MB
  • Word/bingo-irregular-verbs.docx 133.8 kB
  • Word/bingo-irregular-verbs_001.docx 137.1 kB
  • Word/bingo-november-rain.docx 13.0 kB
  • Word/bingo.docx 162.9 kB
  • Word/biographies.docx 13.7 kB
  • Word/bizarre-foods-unit.docx 374.0 kB
  • Word/black-swan.docx 435.6 kB
  • Word/blue-i-can.docx 27.2 kB
  • Word/boared-game-likes-and-dislikes.docx 339.8 kB
  • Word/bob-marley.docx 15.2 kB
  • Word/body-board-game.docx 432.0 kB
  • Word/body-idioms.docx 27.9 kB
  • Word/body-parts-puzzle.docx 19.3 kB
  • Word/body-parts.docx 131.5 kB
  • Word/bonfire-night.docx 41.7 kB
  • Word/book-review-writing-template.docx 105.3 kB
  • Word/bookmarks-classroom-language.docx 1.1 MB
  • Word/born-to-die.docx 23.2 kB
  • Word/boundin.docx 853.8 kB
  • Word/box-2.docx 17.0 kB
  • Word/boys.docx 14.8 kB
  • Word/brain-tricks.docx 5.3 MB
  • Word/brain-tricks_001.docx 4.0 MB
  • Word/brandyhaveyouever.docx 317.9 kB
  • Word/breaking-benjamin-without-you-song-worksheets.docx 128.1 kB
  • Word/bridesmaiddialogueusingoneanditlev2.docx 92.5 kB
  • Word/britains-got-talent-worksheet.docx 18.3 kB
  • Word/britains-got-talent-worksheet_001.docx 18.5 kB
  • Word/british-american-vocabulary.docx 26.4 kB
  • Word/british-superstitions.docx 70.8 kB
  • Word/bruce-almighty.docx 316.2 kB
  • Word/bruce-and-the-cat.docx 25.3 kB
  • Word/bruno-mars-talking-to-the-javtott.docx 37.8 kB
  • Word/bruno-mars.docx 18.8 kB
  • Word/btrworksheet.docx 128.0 kB
  • Word/bubblegumhowitsmade.docx 57.3 kB
  • Word/buildings-and-places.docx 238.8 kB
  • Word/business-excercises.docx 17.1 kB
  • Word/business-idioms.docx 21.4 kB
  • Word/business-vocabulary.docx 16.3 kB
  • Word/busy-teaceher.docx 13.9 kB
  • Word/busy-teacher-present-continuous.docx 298.0 kB
  • Word/busy-teacher-to-be-adjectives.docx 1.7 MB
  • Word/busy-teacher.docx 14.2 kB
  • Word/busy-teacher_001.docx 471.2 kB
  • Word/busy-teacher_002.docx 20.0 kB
  • Word/busy-teacher_003.docx 14.8 kB
  • Word/busy-teacher_004.docx 14.8 kB
  • Word/busy-teacher_005.docx 13.9 kB
  • Word/busy-teacher_006.docx 14.2 kB
  • Word/busy-teacher_007.docx 14.2 kB
  • Word/busy-teacher_008.docx 16.2 kB
  • Word/busy-teachers.docx 358.4 kB
  • Word/busyteacher.docx 24.7 kB
  • Word/c-u-some-a-an.docx 450.9 kB
  • Word/cae-prefix-warmer.docx 14.1 kB
  • Word/calendar-holidays-worksheet.docx 164.1 kB
  • Word/california-king-bed-rihanna-parts-of-the-body.docx 185.5 kB
  • Word/california-king-bed.docx 14.4 kB
  • Word/californication.docx 13.2 kB
  • Word/call-me-maybe-lyrics.docx 191.8 kB
  • Word/camp-rock-segunda-parte.docx 49.3 kB
  • Word/camping-2012.docx 151.7 kB
  • Word/camping-under-the-stars.docx 184.5 kB
  • Word/can-bonomo-love-me-back.docx 14.0 kB
  • Word/can-cant.docx 387.2 kB
  • Word/can-i-go-to-the-bathroom.docx 17.8 kB
  • Word/can-you-talk-about-things-you-like.docx 35.2 kB
  • Word/can.docx 132.8 kB
  • Word/can_cant_for_kids.docx 420.3 kB
  • Word/can_may.docx 12.4 kB
  • Word/car-parts.docx 127.2 kB
  • Word/card-games-questions.docx 34.1 kB
  • Word/cardiff-the-capital-of-wales.docx 585.5 kB
  • Word/cards-foodcounries.docx 1.4 MB
  • Word/carnival.docx 872.4 kB
  • Word/cc-activities.docx 19.0 kB
  • Word/celeste-buckingham-run-run-run.docx 107.3 kB
  • Word/central-park.docx 1.1 MB
  • Word/cereals-reading.docx 36.4 kB
  • Word/chapter-1-5-reading-comprehension-questions.docx 11.4 kB
  • Word/character-adjectives.docx 1.0 MB
  • Word/character-flashcards.docx 386.7 kB
  • Word/characters.docx 14.1 kB
  • Word/charades-cards.docx 712.2 kB
  • Word/charlie-and-the-chocolate-factory.docx 226.1 kB
  • Word/charlie-brown-is-a-great-pumpkin.docx 95.8 kB
  • Word/chemists-pictionary.docx 642.0 kB
  • Word/children-2-revision-2.docx 118.1 kB
  • Word/children-and-watching-tv.docx 62.0 kB
  • Word/chimpanzee-video.docx 15.8 kB
  • Word/chocolate-cake-recipe.docx 130.6 kB
  • Word/choose-the-correct-word-and-colour.docx 360.4 kB
  • Word/chptr-8-ielts-vocab-matching-gap-fill.docx 91.3 kB
  • Word/christmas-adjectives.docx 13.8 kB
  • Word/christmas-in-australia.docx 273.6 kB
  • Word/christmas-in-canada.docx 242.0 kB
  • Word/christmas-in-india.docx 143.6 kB
  • Word/christmas-in-ireland.docx 146.0 kB
  • Word/christmas-in-the-united-kingdom.docx 209.8 kB
  • Word/christmas-is-coming-test-konkursowy.docx 33.9 kB
  • Word/christmas-matching.docx 7.5 MB
  • Word/chritstmas-activities.docx 16.9 kB
  • Word/chritstmas-activities_001.docx 16.9 kB
  • Word/cindarella.docx 22.3 kB
  • Word/cinderella-presentation-2008.docx 328.3 kB
  • Word/cinderella.docx 283.3 kB
  • Word/cinema.docx 163.7 kB
  • Word/class-instructions.docx 27.4 kB
  • Word/class-room-language.docx 590.9 kB
  • Word/classify-the-following-items-according-to-the.docx 731.3 kB
  • Word/classroom-flashcards.docx 206.6 kB
  • Word/classroom-language.docx 310.5 kB
  • Word/classroom-language_001.docx 321.4 kB
  • Word/classroom-posters.docx 345.9 kB
  • Word/classroom-rules-and-procedures.docx 14.9 kB
  • Word/classroom-rules-ok.docx 1.1 MB
  • Word/classroom-verbs-2011.docx 2.9 MB
  • Word/clauses-and-linkers-of-contrast.docx 90.3 kB
  • Word/climate-and-seasons.docx 236.0 kB
  • Word/climate-change.docx 14.1 kB
  • Word/clipart-for-song.docx 333.1 kB
  • Word/clothes-battleships.docx 382.3 kB
  • Word/clothes-board-game.docx 267.1 kB
  • Word/clothes-crossword.docx 247.4 kB
  • Word/clothes-crossword_001.docx 247.4 kB
  • Word/clothes-crossword_002.docx 247.4 kB
  • Word/clothes-flash.docx 783.6 kB
  • Word/clothes-missing.docx 284.9 kB
  • Word/clothes-riddles.docx 15.5 kB
  • Word/clothes.docx 83.9 kB
  • Word/clothes_001.docx 279.8 kB
  • Word/clothes_002.docx 20.0 kB
  • Word/clothing-accessories-jewellery.docx 376.2 kB
  • Word/clouds-across-the-moon.docx 337.6 kB
  • Word/cloudy-with-a-chance-of-meatballs.docx 11.2 kB
  • Word/cluasers-and-linkers-of-contrast.docx 89.9 kB
  • Word/clue.docx 2.8 MB
  • Word/coditionals-table.docx 13.5 kB
  • Word/coldplay-xmas-lights.docx 15.9 kB
  • Word/coldplayfixu-1.docx 337.6 kB
  • Word/colegio-cristiano-1a.docx 4.5 MB
  • Word/collective-nouns-grade-6.docx 134.5 kB
  • Word/collective-nouns.docx 267.0 kB
  • Word/colour-in-healthy-foods.docx 700.4 kB
  • Word/colour-in-the-country.docx 384.8 kB
  • Word/colours-and-prepositions.docx 29.0 kB
  • Word/colours-mini.docx 334.3 kB
  • Word/common-verbs.docx 28.3 kB
  • Word/comp-super.docx 421.9 kB
  • Word/comp-superl2.docx 14.9 kB
  • Word/comparative-adjective.docx 771.2 kB
  • Word/comparative-and-superlative-adjectives-revision.docx 21.9 kB
  • Word/comparative-and-superlative.docx 15.1 kB
  • Word/comparative-superlative-reading-activity.docx 36.9 kB
  • Word/comparative-superlative-reading-activity_001.docx 36.9 kB
  • Word/comparative-superlative.docx 57.7 kB
  • Word/comparative-young-learners.docx 234.8 kB
  • Word/comparatives-and-superlatives.docx 11.7 kB
  • Word/comparatives-pre-pet.docx 14.0 kB
  • Word/comparatives-reveiw-practice.docx 15.8 kB
  • Word/comparatives.docx 80.9 kB
  • Word/comparatives_001.docx 155.9 kB
  • Word/compare-the-pictures-opposites.docx 189.8 kB
  • Word/complete-the-gaps-with-one-word.docx 176.7 kB
  • Word/complete-the-sentences-with-one-of-these.docx 12.5 kB
  • Word/complete-with-am.docx 120.4 kB
  • Word/complex-object-2.docx 39.4 kB
  • Word/complex-object.docx 35.7 kB
  • Word/complex-object_the-rules.docx 45.0 kB
  • Word/complicatedactividad.docx 120.9 kB
  • Word/compound-nouns.docx 148.0 kB
  • Word/comprehension-page-11.docx 18.3 kB
  • Word/computer-parts-crossword.docx 251.0 kB
  • Word/computers.docx 452.0 kB
  • Word/concept-check-symptoms.docx 493.7 kB
  • Word/concessive-clauses.docx 98.9 kB
  • Word/conditional-clauses_prehled.docx 12.2 kB
  • Word/conditional-sentences-game.docx 79.6 kB
  • Word/conditional-sentences.docx 16.3 kB
  • Word/conditional.docx 186.5 kB
  • Word/conditionalclauses-1.docx 38.5 kB
  • Word/conditionals-4-typesmixed-cond.docx 653.6 kB
  • Word/conditionals-4-typesmixed-cond_001.docx 1.1 MB
  • Word/conditionals-4-typesmixed-cond_1_.docx 809.2 kB
  • Word/conditionals-ii.docx 309.8 kB
  • Word/conditionals-type-0-1-2.docx 18.7 kB
  • Word/conditionals-written-exercise.docx 13.7 kB
  • Word/conditionals.docx 166.0 kB
  • Word/conditionals_revised_Busy_Teacher.docx 159.8 kB
  • Word/conditionalsfinishsentences.docx 76.4 kB
  • Word/connect-4.docx 19.5 kB
  • Word/context-clues2.docx 12.7 kB
  • Word/contractions.docx 586.4 kB
  • Word/contractions_001.docx 58.4 kB
  • Word/contries-and-nationalities.docx 27.8 kB
  • Word/conversation-questions.docx 17.8 kB
  • Word/coordinating-conjunctions.docx 85.0 kB
  • Word/cootie-catcher.docx 94.5 kB
  • Word/coraline-worksheet.docx 1.1 MB
  • Word/costume-diploma.docx 254.1 kB
  • Word/count-to-ten.docx 679.3 kB
  • Word/countable-and-uncountable-nouns.docx 140.1 kB
  • Word/countable-cards.docx 1.1 MB
  • Word/countable-uncountable-nouns.docx 129.4 kB
  • Word/countable-uncountable-nouns_001.docx 62.3 kB
  • Word/countries-and-nationalities.docx 237.5 kB
  • Word/countries-and-nationalities_001.docx 112.2 kB
  • Word/countries-and-nationalities_002.docx 95.8 kB
  • Word/countries-nationalities-extra-exercises.docx 97.8 kB
  • Word/countries-person-and-nation-hodilka.docx 42.8 kB
  • Word/couple-game-places-in-the-city.docx 740.5 kB
  • Word/cradleandall.docx 192.9 kB
  • Word/craig-david-activities.docx 20.7 kB
  • Word/creative-writing-leisure-time.docx 395.2 kB
  • Word/cri.docx 2.9 kB
  • Word/crime-and-punishment.docx 283.4 kB
  • Word/crime_or_offense_definition_answer-2.docx 21.7 kB
  • Word/critical-thinking-2sem.docx 1.3 MB
  • Word/crossword-irregular-verbs.docx 202.0 kB
  • Word/crossword-the-farm.docx 184.7 kB
  • Word/crosswords-3.docx 23.9 kB
  • Word/cryonics.docx 21.6 kB
  • Word/cumulative-tense-test-a.docx 99.0 kB
  • Word/current-events-eoc.docx 30.9 kB
  • Word/daily-activities.docx 309.3 kB
  • Word/daily-assessment-2-grade-11-2.docx 111.0 kB
  • Word/daily-phrases-1.docx 14.3 kB
  • Word/daily-routine.docx 209.1 kB
  • Word/david-byrne-song-simple-past.docx 15.5 kB
  • Word/days-and-months-reparado.docx 191.1 kB
  • Word/days-of-the-week.docx 219.7 kB
  • Word/dearschoolnurse.docx 92.8 kB
  • Word/defining-relative-clauses.docx 75.8 kB
  • Word/degrees-of-comparison.docx 64.1 kB
  • Word/demis-rusos.docx 391.3 kB
  • Word/demonstrative-pronouns.docx 412.0 kB
  • Word/demonstrative-pronouns_001.docx 13.3 kB
  • Word/demonstratives-questions-and-short-answers.docx 163.3 kB
  • Word/demostrativos-ejercicios.docx 49.5 kB
  • Word/derivation-new-msbee.docx 20.2 kB
  • Word/derivatives-from-use.docx 93.3 kB
  • Word/describe-a-picture-present-continuous.docx 1.5 MB
  • Word/describe-a-picture.docx 1.9 MB
  • Word/describe-a-picture_001.docx 205.0 kB
  • Word/describe-the-simpsons.docx 143.8 kB
  • Word/describe-these-people.docx 80.2 kB
  • Word/describe-your-person.docx 54.5 kB
  • Word/describe-your-person_2_.docx 54.2 kB
  • Word/describing-big-ben.docx 144.3 kB
  • Word/describing-feelings-and-personality.docx 13.3 kB
  • Word/describing-people-guess-who.docx 3.9 MB
  • Word/describing-people.docx 23.1 kB
  • Word/describing-people_001.docx 182.6 kB
  • Word/describing-someone.docx 281.3 kB
  • Word/describing-your-house.docx 15.1 kB
  • Word/descriptions.docx 1.6 MB
  • Word/descriptions_001.docx 16.9 kB
  • Word/dialogue-ideas.docx 15.7 kB
  • Word/diets-and-healthy-nutrition.docx 17.4 kB
  • Word/diets-and-healthy-nutrition_001.docx 17.7 kB
  • Word/dilemma-what-do-you-consider.docx 63.5 kB
  • Word/directions-7.docx 178.2 kB
  • Word/disabilities_worksheet.docx 15.5 kB
  • Word/discourse-markers-worksheet.docx 15.5 kB
  • Word/divination-class.docx 87.7 kB
  • Word/diy-parts-of-speech-poem.docx 1.7 MB
  • Word/djokovic-seals-his-place-at-the-head-of-new-world.docx 38.7 kB
  • Word/dni-nedeli-s-vinni-puxom.docx 346.4 kB
  • Word/do-does-simple-present.docx 15.8 kB
  • Word/do-you-believe.docx 14.1 kB
  • Word/do-you-know-me.docx 148.8 kB
  • Word/do-you-know-my-name.docx 208.7 kB
  • Word/do-you-know-the-alphabet.docx 21.9 kB
  • Word/do-you-live-in-a-burglar-friendly-house.docx 340.4 kB
  • Word/do-you-ynow-the-history-behind-toasting.docx 19.5 kB
  • Word/doc-1.docx 47.3 kB
  • Word/doc1.docx 317.8 kB
  • Word/doc1_001.docx 683.3 kB
  • Word/Doc2.docx 577.1 kB
  • Word/doc4.docx 72.6 kB
  • Word/doctor-who.docx 279.9 kB
  • Word/dogspetsintermediate.docx 120.4 kB
  • Word/dok1.docx 187.6 kB
  • Word/dokument-microsoft-office-word-97-2003-3.docx 117.9 kB
  • Word/dokument-microsoft-office-word.docx 17.1 kB
  • Word/dokument-microsoft-word-4.docx 23.2 kB
  • Word/domino-verbs-nouns.docx 20.6 kB
  • Word/dominoes.docx 804.6 kB
  • Word/dont-give-up-song-worksheet.docx 31.9 kB
  • Word/dont-worry-be-happy-bobby-mcferrin-fill-in-the.docx 183.9 kB
  • Word/dont-worry-child.docx 258.5 kB
  • Word/dontgiveup.docx 45.3 kB
  • Word/dontgiveup_001.docx 44.3 kB
  • Word/door-to-door.docx 113.8 kB
  • Word/dopasuj-nazw281-kraju-do-flagi.docx 189.0 kB
  • Word/dopresent-simple-or-continuous-2011-n.docx 687.7 kB
  • Word/dopresent-simple-or-continuous-2011-n_001.docx 691.7 kB
  • Word/double-comparatives.docx 160.7 kB
  • Word/dream-on-activity.docx 16.6 kB
  • Word/dumb-ways-to-die.docx 17.8 kB
  • Word/dumb-ways.docx 12.9 kB
  • Word/e-c-c-e-e-x-a-m-s-tips.docx 22.7 kB
  • Word/east-17.docx 297.6 kB
  • Word/easter-crossword.docx 75.1 kB
  • Word/easter-missing.docx 307.4 kB
  • Word/easter-worksheet-color-cut.docx 128.6 kB
  • Word/easter-worksheet.docx 75.2 kB
  • Word/easter.docx 6.7 MB
  • Word/easy-questions-and-answers-1.docx 14.5 kB
  • Word/easy-questions-and-answers-1_001.docx 14.4 kB
  • Word/eating-habits_cards.docx 870.0 kB
  • Word/edinburgh-festivals.docx 19.8 kB
  • Word/eding-adj-razlaga.docx 270.0 kB
  • Word/editing.docx 13.7 kB
  • Word/education-school.docx 12.6 kB
  • Word/egyptian-pyramids.docx 131.8 kB
  • Word/einsteins-enignma.docx 13.6 kB
  • Word/eleanor-rigby.docx 14.9 kB
  • Word/electrodomesticos2.docx 1.3 MB
  • Word/electronic-devices.docx 542.5 kB
  • Word/elton-john-someday-out-of-the-blue.docx 1.1 MB
  • Word/emily-dickinson.docx 363.5 kB
  • Word/empire-state-of-mind-alicia-keys-worksheet.docx 106.8 kB
  • Word/english-department.docx 27.2 kB
  • Word/english-i-unit-3-planning-submit.docx 73.7 kB
  • Word/english-lessons-assessment.docx 38.6 kB
  • Word/english-practice-present.docx 83.1 kB
  • Word/english-superstitions.docx 16.7 kB
  • Word/english-test-5th-grade-january.docx 1.5 MB
  • Word/english-test-common-expressions-answers.docx 13.7 kB
  • Word/english-test-common-expressions.docx 12.2 kB
  • Word/english-test-nouns.docx 14.2 kB
  • Word/english-test-unit-1-dovi.docx 109.6 kB
  • Word/english-test-unit-1-dovi_001.docx 109.6 kB
  • Word/english_lesson_planaugust27-1th.docx 59.2 kB
  • Word/enterprise-unit-19.docx 3.3 MB
  • Word/env.docx 606.8 kB
  • Word/envelope.docx 16.9 kB
  • Word/environmental-threats-intro.docx 19.6 kB
  • Word/esl-questionanswer-game.docx 14.7 kB
  • Word/eternal-flame.docx 12.5 kB
  • Word/euphemisms-handout.docx 15.3 kB
  • Word/euro-2012.docx 640.8 kB
  • Word/euthanasia-nl.docx 130.8 kB
  • Word/every-breath-you-take.docx 176.7 kB
  • Word/everybody-talks.docx 14.9 kB
  • Word/everybodys-changing.docx 240.6 kB
  • Word/everything-at-once-lnka.docx 381.0 kB
  • Word/everything-at-once-lyrics.docx 15.6 kB
  • Word/exercise-1.docx 12.0 kB
  • Word/exercises-describing-famous-people.docx 401.9 kB
  • Word/exercises-for-elementary-students-2.docx 19.6 kB
  • Word/exercises-for-elementary-students.docx 20.0 kB
  • Word/exercises-for-the-lesson.docx 12.6 kB
  • Word/exercises-going-to-will-pr-cont.docx 13.0 kB
  • Word/expressing-wishes-and-regerets.docx 213.4 kB
  • Word/expressingobligationwithschedulesactivity.docx 19.9 kB
  • Word/expressions-with-time.docx 38.1 kB
  • Word/extra-activities-school-object-1st-children.docx 4.5 MB
  • Word/extraterrestrials.docx 2.1 MB
  • Word/extreme-sports.docx 1.2 MB
  • Word/extreme-sports_wingsuit-skydiving.docx 135.0 kB
  • Word/facts.docx 18.9 kB
  • Word/fair-game-mixed-tenses.docx 1.2 MB
  • Word/fairy-tales.docx 290.4 kB
  • Word/families-co-elllo-613-correction.docx 14.5 kB
  • Word/family-cards.docx 14.1 kB
  • Word/family-green-text-for-making-questions.docx 46.6 kB
  • Word/family-test-ms1.docx 51.9 kB
  • Word/family-topic.docx 216.3 kB
  • Word/family-tree.docx 260.4 kB
  • Word/family.docx 183.5 kB
  • Word/famous-people.docx 36.5 kB
  • Word/famtree_oaktree.docx 445.4 kB
  • Word/fashion.docx 90.9 kB
  • Word/fb-and-chat-language.docx 55.0 kB
  • Word/fce.docx 35.3 kB
  • Word/feb-2011-legal-exam-paper.docx 89.4 kB
  • Word/feelings_idioms.docx 12.3 kB
  • Word/felix-baumgartner.docx 38.1 kB
  • Word/fet_image.docx 992.7 kB
  • Word/fet_memo.docx 821.7 kB
  • Word/fet_print.docx 1.1 MB
  • Word/fet_speak.docx 874.7 kB
  • Word/fet_speak_2.docx 1.1 MB
  • Word/fiche-vidjo-peace-corps.docx 13.8 kB
  • Word/fierce-snake-fact-sheet.docx 112.5 kB
  • Word/fifty-first-dates.docx 197.0 kB
  • Word/fill-in-the-blanks-with-present-perfect-tense.docx 22.1 kB
  • Word/fill-in-the-blanks.docx 177.7 kB
  • Word/filthy-cities-comprehension-london.docx 13.8 kB
  • Word/filthy-cities-comprehension.docx 14.7 kB
  • Word/final-test-3-jovenes-c-2011-modificado.docx 31.9 kB
  • Word/final-test-4-periodo.docx 7.4 MB
  • Word/final-tests-3rd-qtrd.docx 2.1 MB
  • Word/find-someone-who-adjectives.docx 11.1 kB
  • Word/find-someone-who-print.docx 147.0 kB
  • Word/find-someone-who-sports-2nd-grade.docx 13.6 kB
  • Word/find-someone-who-used-to.docx 13.2 kB
  • Word/find-someone-who.docx 145.1 kB
  • Word/find-someone-who_001.docx 13.8 kB
  • Word/find-someone-who_002.docx 13.7 kB
  • Word/find-the-irregular-2.docx 159.5 kB
  • Word/find-the-irregular-3.docx 228.6 kB
  • Word/find-the-irregular.docx 130.2 kB
  • Word/finger-plays.docx 16.2 kB
  • Word/finish-the-sentence-speaking-activity.docx 19.4 kB
  • Word/fireflies-night-owl.docx 48.1 kB
  • Word/firework-lyrics.docx 791.4 kB
  • Word/firework.docx 15.1 kB
  • Word/first-conditional-2011.docx 171.3 kB
  • Word/first-conditional-dominoes.docx 11.3 kB
  • Word/first-conditional.docx 148.7 kB
  • Word/first-lesson-icebreaker.docx 18.4 kB
  • Word/first-second-third-person-hunts.docx 67.9 kB
  • Word/five-little-monkeys.docx 139.9 kB
  • Word/five-senses-worksheet.docx 85.5 kB
  • Word/fix-you-cold-play.docx 27.7 kB
  • Word/flags.docx 113.4 kB
  • Word/flash-cards.docx 1.4 MB
  • Word/flashcard-reported-questions.docx 1.0 MB
  • Word/flashcard_reported_questions.docx 1.0 MB
  • Word/flashcards-daily-activities.docx 352.3 kB
  • Word/flashcards-for-kindergarten-quiz.docx 291.3 kB
  • Word/flashcards-rep-statements-commands-and-requests.docx 1.2 MB
  • Word/flashcards.docx 167.6 kB
  • Word/flowers.docx 1.2 MB
  • Word/follow-simple-instruction-tasks.docx 15.4 kB
  • Word/food-cards.docx 12.7 kB
  • Word/food-spelling.docx 464.3 kB
  • Word/food-test.docx 14.0 kB
  • Word/food.docx 1.2 MB
  • Word/food_001.docx 365.8 kB
  • Word/food_002.docx 523.0 kB
  • Word/foodsheet.docx 360.8 kB
  • Word/for-during-while.docx 470.7 kB
  • Word/form-adjectives-from-the-words.docx 502.1 kB
  • Word/formal-versus-informal-no-logo.docx 17.9 kB
  • Word/formes-personnelle-et-cas-possessif.docx 15.2 kB
  • Word/fortune-teller.docx 197.3 kB
  • Word/fox-in-socks.docx 329.6 kB
  • Word/frank-sinatra-new-york.docx 13.4 kB
  • Word/freaky-friday-worksheet.docx 20.6 kB
  • Word/fridgyy.docx 579.1 kB
  • Word/Friend_and_Family_Addresses.docx 10.5 kB
  • Word/friends-6x09.docx 139.5 kB
  • Word/friends-halloween-episode.docx 17.1 kB
  • Word/friends-the-rumour.docx 136.7 kB
  • Word/friends-will-be-friends-lyric.docx 14.8 kB
  • Word/friends.docx 531.4 kB
  • Word/friends_001.docx 222.8 kB
  • Word/friends_002.docx 12.5 kB
  • Word/fringe.docx 1.3 MB
  • Word/frog-and-toad-the-garden-worksheet.docx 16.4 kB
  • Word/Frog_and_Toad_The_garden_Worksheet.docx 16.9 kB
  • Word/from-head-to-toe.docx 14.8 kB
  • Word/frosty-the-snowman.docx 13.8 kB
  • Word/fruit.docx 654.8 kB
  • Word/fruits-and-vegetables.docx 860.8 kB
  • Word/fruits-flashcards.docx 381.8 kB
  • Word/fruits.docx 148.8 kB
  • Word/fruits_001.docx 1.2 MB
  • Word/funny-language.docx 1.2 MB
  • Word/funnyinventionspictures.docx 265.6 kB
  • Word/furniture-prepositions-cut-and-stick.docx 155.1 kB
  • Word/furniture-prepositions-cut-and-stick_001.docx 326.3 kB
  • Word/future-forms.docx 17.1 kB
  • Word/future-tense.docx 15.3 kB
  • Word/future-tenses-exercises.docx 206.8 kB
  • Word/future-tenses.docx 27.9 kB
  • Word/future-will-going-to-present-continuous-present.docx 205.2 kB
  • Word/future-will-infinitive.docx 209.3 kB
  • Word/future-will-infinitive_001.docx 232.9 kB
  • Word/FUTURE_PROJECT_FRIDAY.docx 158.8 kB
  • Word/gaga.docx 66.5 kB
  • Word/game-opposites.docx 17.9 kB
  • Word/game.docx 2.8 MB
  • Word/game_001.docx 11.5 kB
  • Word/game_002.docx 14.5 kB
  • Word/game_003.docx 13.8 kB
  • Word/garfield-back-to-school-test.docx 33.2 kB
  • Word/garfield-friends-the-great-gateway-worksheet.docx 140.8 kB
  • Word/garfield-present-simple-role-play-adverbs-of.docx 501.7 kB
  • Word/garfield-worksheet.docx 276.8 kB
  • Word/gerund-and-infinitive-a.docx 53.0 kB
  • Word/gerund-or-infinitive.docx 22.0 kB
  • Word/gerund-or-infinitive_001.docx 23.8 kB
  • Word/gerund-or-infintive-happy-new-years.docx 97.6 kB
  • Word/gerunds-and-infinitives-worksheet.docx 317.6 kB
  • Word/getting-to-know-you-exercise.docx 74.3 kB
  • Word/getting-to-know-you.docx 13.3 kB
  • Word/gingerbread-man-handout-2nd.docx 17.2 kB
  • Word/girl-barred-from-top-store.docx 205.5 kB
  • Word/girl-on-fire-by-alicia-keys.docx 200.6 kB
  • Word/giving-directions-flash.docx 357.5 kB
  • Word/giza-pyramids.docx 363.4 kB
  • Word/glad-you-came_complete.docx 7.9 kB
  • Word/global-warming.docx 16.4 kB
  • Word/going-to-the-doctor.docx 16.4 kB
  • Word/good-night-mr-bean-video-activity.docx 51.2 kB
  • Word/good-night-mr-bean-video-activity_001.docx 51.2 kB
  • Word/good-time-owl-city-song.docx 12.6 kB
  • Word/goodnight-goodnight-by-maroon.docx 35.1 kB
  • Word/gotye-somebody-that-i-used-to-know.docx 18.7 kB
  • Word/grade-3-spelling-book.docx 155.8 kB
  • Word/grammar-exercises.docx 40.9 kB
  • Word/grammar-quiz-_-units-11-12.docx 14.6 kB
  • Word/grammar-revision.docx 535.6 kB
  • Word/greek-and-latin-roots-test.docx 12.8 kB
  • Word/green-eyes.docx 135.3 kB
  • Word/green-lantern.docx 82.7 kB
  • Word/greetings.docx 1.1 MB
  • Word/greg-granger-gave-gretta-green-grapes.docx 11.5 kB
  • Word/grenade-bruno-mars.docx 61.1 kB
  • Word/grocery-shopping1.docx 50.2 kB
  • Word/group-session-module-3-health-and-environment.docx 24.3 kB
  • Word/group-work.docx 304.7 kB
  • Word/grvii_eng_ws_clauses1.docx 36.7 kB
  • Word/grvii_eng_ws_clauses1_001.docx 37.8 kB
  • Word/gsl-the-general-service-list-by-michael-west-1953.docx 47.0 kB
  • Word/gsl-the-general-service-list-by-michael-west-1953_001.docx 44.8 kB
  • Word/gsl-the-general-service-list-by-michael-west-1953_002.docx 44.8 kB
  • Word/gua-de-ejercicios-n2.docx 437.7 kB
  • Word/guess-guinness.docx 14.7 kB
  • Word/guess-the-animal-game.docx 65.3 kB
  • Word/guess-who-questions.docx 184.3 kB
  • Word/guess-who.docx 467.0 kB
  • Word/gypsy-role-play.docx 51.2 kB
  • Word/h.docx 132.4 kB
  • Word/hair-stylesdescriptions.docx 255.7 kB
  • Word/halloween-8th-form.docx 327.6 kB
  • Word/halloween-case-study.docx 22.6 kB
  • Word/halloween-history.docx 15.1 kB
  • Word/halloween-missing.docx 1.9 MB
  • Word/halloween-story.docx 152.4 kB
  • Word/halloween-workshop.docx 78.4 kB
  • Word/halloween.docx 21.3 kB
  • Word/halloween_001.docx 351.6 kB
  • Word/halloween_listening.docx 69.3 kB
  • Word/handout-past-simple.docx 75.0 kB
  • Word/handout-past-simple_001.docx 5 Bytes
  • Word/handout_numbers.docx 84.8 kB
  • Word/haunted-house-directions.docx 313.0 kB
  • Word/haunted-mansion.docx 325.0 kB
  • Word/haunted-mansion_001.docx 325.0 kB
  • Word/haunted-mansion_VERBS_PASSIVE.docx 150.5 kB
  • Word/haunted-mansion_VERBS_PASSIVE_001.docx 150.5 kB
  • Word/have-got-has-got.docx 514.0 kB
  • Word/have-got-ii.docx 150.7 kB
  • Word/have-got_has-got_personal-descriptions.docx 51.0 kB
  • Word/have-has-got.docx 380.6 kB
  • Word/have-has.docx 16.5 kB
  • Word/have-to-doesnt-have-to-worksheet.docx 74.3 kB
  • Word/have-to-worksheet.docx 324.9 kB
  • Word/have-to.docx 40.2 kB
  • Word/have-you-ever-1.docx 309.6 kB
  • Word/have-you-ever-cards.docx 795.3 kB
  • Word/have-you-ever-interviews-plus-revision-of-present.docx 14.2 kB
  • Word/have-you-ever-interviews-plus-revision-of-present_001.docx 14.1 kB
  • Word/have-you-ever.docx 14.5 kB
  • Word/have-you-got-a-blackberry-possessions.docx 12.3 kB
  • Word/have_to_Worksheet.docx 325.3 kB
  • Word/havent-met-you-yet.docx 58.1 kB
  • Word/haventmetyouyet_michaelbuble.docx 16.1 kB
  • Word/hazard.docx 16.3 kB
  • Word/head-shoulder-knees-and-toes-clothes.docx 151.7 kB
  • Word/headgear.docx 2.0 MB
  • Word/health-and-body-taboo.docx 18.8 kB
  • Word/health-and-sickness.docx 15.8 kB
  • Word/health-flash.docx 114.6 kB
  • Word/health-test.docx 16.7 kB
  • Word/health_and_body_taboo.docx 18.8 kB
  • Word/health_and_body_taboo_001.docx 18.9 kB
  • Word/health_and_body_taboo_002.docx 18.9 kB
  • Word/Health_and_Sickness.docx 15.8 kB
  • Word/help-station-posters.docx 969.5 kB
  • Word/here-to-becompostion-describing-a-place.docx 27.0 kB
  • Word/here-to-becompostion-describing-a-place_001.docx 24.2 kB
  • Word/hey-hey-hey.docx 398.3 kB
  • Word/hey-soul-sister.docx 114.4 kB
  • Word/high-school-never-ends-song-questions.docx 19.6 kB
  • Word/high-school-text-and-questions.docx 19.6 kB
  • Word/his-her.docx 104.3 kB
  • Word/ho-hey.docx 21.9 kB
  • Word/hobbies-and-sports.docx 221.7 kB
  • Word/hobbies-pict-cross.docx 870.3 kB
  • Word/hobbies.docx 440.2 kB
  • Word/hoja_de_vida_de_camacholis_5_.docx 41.2 kB
  • Word/holiday.docx 516.5 kB
  • Word/home-sweet-home.docx 350.6 kB
  • Word/homecoming-by-kanye-west.docx 127.7 kB
  • Word/homographs-1.docx 208.7 kB
  • Word/homonyms-domino.docx 12.2 kB
  • Word/honeymoon-questions.docx 113.1 kB
  • Word/hot-and-cold.docx 18.2 kB
  • Word/hot-and-cold_001.docx 186.5 kB
  • Word/hot-cold.docx 190.6 kB
  • Word/hot-seat-game.docx 112.2 kB
  • Word/hotel-california.docx 23.6 kB
  • Word/house-of-anubis.docx 240.4 kB
  • Word/house-vocabulary.docx 71.5 kB
  • Word/house.docx 365.9 kB
  • Word/household-2011.docx 185.3 kB
  • Word/houses.docx 1.1 MB
  • Word/how-are-you-feeling-today.docx 67.8 kB
  • Word/how-are-you-feeling-wordsearch1.docx 983.4 kB
  • Word/how-coyote-made-the-winter.docx 1.6 MB
  • Word/how-do-you-feel-when-you-listen-to-these-songs.docx 28.9 kB
  • Word/how-fashionable-are-you.docx 135.3 kB
  • Word/how-glass-is-made.docx 292.2 kB
  • Word/how-i-met-your-mother-1.docx 22.5 kB
  • Word/how-its-made.docx 167.0 kB
  • Word/how-long-worksheet.docx 63.1 kB
  • Word/how-many-fruit.docx 301.3 kB
  • Word/how-much-is-it.docx 66.0 kB
  • Word/how-often-do-you.docx 142.2 kB
  • Word/how-often-do-you_001.docx 1.0 MB
  • Word/how-old-are.docx 175.0 kB
  • Word/how-to-make-a-sandwich-firstthennext.docx 18.0 kB
  • Word/how-to-reduce-christmas-waste.docx 529.0 kB
  • Word/how-you-feel.docx 23.9 kB
  • Word/human-bingo.docx 47.1 kB
  • Word/hurricane-sandy-video-lesson.docx 16.7 kB
  • Word/i-am-lazy-and-i-know-it.docx 13.1 kB
  • Word/i-don-t-like.docx 98.5 kB
  • Word/i-dont-want-to-miss-a-thing-aerosmith.docx 14.8 kB
  • Word/i-dont-want-to-miss-a-thing-aerosmith_001.docx 257.3 kB
  • Word/i-dont-want-to-miss-a-thing-aerosmith_002.docx 14.9 kB
  • Word/i-have-got-by-kik.docx 147.7 kB
  • Word/i-have.docx 247.4 kB
  • Word/i-play-the-who-plays-musical-instruments-1.docx 748.3 kB
  • Word/i-still-haven180t-found-what.docx 24.7 kB
  • Word/i-still-havent-found-u2.docx 133.3 kB
  • Word/i-too-sing-america.docx 331.1 kB
  • Word/i-will-love-again-puzzle-full-activity.docx 69.8 kB
  • Word/i-will.docx 25.6 kB
  • Word/i-wish-lyrics.docx 14.0 kB
  • Word/i.docx 12.3 kB
  • Word/i_001.docx 101.3 kB
  • Word/I_002.docx 33.1 kB
  • Word/I_too_sing_America_BARVNA.docx 331.1 kB
  • Word/ian-s.docx 1.2 MB
  • Word/ice-age.docx 4.7 MB
  • Word/icebreakers.docx 25.0 kB
  • Word/ict-shakespeare.docx 48.2 kB
  • Word/ideas.docx 12.8 kB
  • Word/idiom-dialogue.docx 14.9 kB
  • Word/idiomatic-crime.docx 19.0 kB
  • Word/idiomatic-expressions-1.docx 14.3 kB
  • Word/idioms.docx 13.9 kB
  • Word/idioms_001.docx 18.2 kB
  • Word/ielts-vocabulary-handout.docx 18.9 kB
  • Word/if-clauses-type-2.docx 79.3 kB
  • Word/if-flashcards.docx 1.4 MB
  • Word/if-flashcards_001.docx 1.4 MB
  • Word/if-i-controlled-the-internet.docx 18.9 kB
  • Word/if-i-had-a-million-dollars-2.docx 1.1 MB
  • Word/if-i-had-a-million-dollars.docx 14.2 kB
  • Word/if-i-were-a-boy-task.docx 12.1 kB
  • Word/if-i-were-a-boy.docx 20.7 kB
  • Word/if-sentences-mixed.docx 16.1 kB
  • Word/if-sentences-mixed_001.docx 16.4 kB
  • Word/ifwish-board-game.docx 282.8 kB
  • Word/igk-gyakorls.docx 479.7 kB
  • Word/ii.docx 109.9 kB
  • Word/illnesses.docx 309.0 kB
  • Word/im-a-big-big-girl.docx 233.7 kB
  • Word/im-wide-awake-katy-perry.docx 803.0 kB
  • Word/im-yours-listening-lesson-revised.docx 16.6 kB
  • Word/imaginary-monster.docx 48.0 kB
  • Word/imperative-board-game.docx 32.6 kB
  • Word/imperative-voice-test.docx 14.7 kB
  • Word/imperatives-with-aches-and-pains.docx 304.0 kB
  • Word/impromptu-speech-activity.docx 16.1 kB
  • Word/in-my-flat-there-is.docx 83.5 kB
  • Word/in-my-house-review.docx 291.3 kB
  • Word/in-on-under.docx 11.0 kB
  • Word/in-other-words-passive-voice.docx 13.4 kB
  • Word/in-other-words.docx 34.3 kB
  • Word/in-sickness-and-health.docx 132.3 kB
  • Word/in-the-evening.docx 153.2 kB
  • Word/in-the-shadows.docx 12.4 kB
  • Word/indefinite-pronouns.docx 356.2 kB
  • Word/indefinte-pronouns.docx 252.3 kB
  • Word/infinitive-or.docx 19.1 kB
  • Word/infinitive-practice-sheet.docx 67.4 kB
  • Word/information-gap-house-tree-car-moon-stars.docx 178.9 kB
  • Word/injured-bald-eagle-rescued-by-d.docx 254.3 kB
  • Word/inside-task.docx 89.6 kB
  • Word/instructions-microwave-cake.docx 15.9 kB
  • Word/int-2-day-1.docx 360.4 kB
  • Word/int-2-unit-6.docx 272.0 kB
  • Word/int-2-unit-6_001.docx 17.0 kB
  • Word/int.docx 14.7 kB
  • Word/interesting-facts-about-the-usa.docx 368.2 kB
  • Word/intermediate-conversation-business-resume.docx 35.2 kB
  • Word/international-landmarks.docx 193.9 kB
  • Word/internet-flashcards.docx 1.6 MB
  • Word/interviewing.docx 18.9 kB
  • Word/into-the-dark.docx 17.2 kB
  • Word/intorduction-numbers-to-10-likes-dislikes.docx 523.0 kB
  • Word/introduce.docx 142.6 kB
  • Word/introducing-friends.docx 201.5 kB
  • Word/introductions2.docx 15.9 kB
  • Word/inversion.docx 12.5 kB
  • Word/iphone-4s.docx 13.5 kB
  • Word/ipod-nan1-ms-4.docx 198.0 kB
  • Word/ir-verbs-rhymes.docx 194.4 kB
  • Word/ir11sep.docx 968.0 kB
  • Word/iron-lady-opinion-article.docx 128.2 kB
  • Word/irregular-ok.docx 1.5 MB
  • Word/irregular-past-tense-verbs.docx 11.3 kB
  • Word/irregular-verbs-1.docx 71.1 kB
  • Word/irregular-verbs-chart.docx 24.7 kB
  • Word/irregular-verbs-game.docx 626.9 kB
  • Word/irregular-verbs-past-simple.docx 224.3 kB
  • Word/irregular-verbs-test.docx 12.0 kB
  • Word/irregular-verbs-test_001.docx 19.8 kB
  • Word/irregular-verbs.docx 283.3 kB
  • Word/irregulars-in-past-simple_flashcards-1.docx 498.8 kB
  • Word/irregulars-in-past-simple_flashcards-2.docx 898.9 kB
  • Word/irregulars-patterns-2.docx 68.8 kB
  • Word/irregulars-patterns-3.docx 103.8 kB
  • Word/isisntarearent-and-aan.docx 116.6 kB
  • Word/it-is-forbidden-not-allowed.docx 11.0 kB
  • Word/it-will-rain-worksheet.docx 113.8 kB
  • Word/it.docx 178.1 kB
  • Word/its-my-life.docx 245.4 kB
  • Word/Ivanhoe_Names.docx 11.6 kB
  • Word/ive-seen-it-all.docx 14.6 kB
  • Word/ive_got.docx 1.2 MB
  • Word/jeremy.docx 145.7 kB
  • Word/jessie-j-whos-laughing-now.docx 17.5 kB
  • Word/jobs-56.docx 832.5 kB
  • Word/jobs-board-game.docx 289.9 kB
  • Word/jobs-guessing-game.docx 18.6 kB
  • Word/jobs.docx 12.2 kB
  • Word/jobs_001.docx 2.1 MB
  • Word/jobs_002.docx 194.7 kB
  • Word/jobs_003.docx 42.6 kB
  • Word/john-taboo-game.docx 10.3 kB
  • Word/john-tucker-must-die-worksheet.docx 570.4 kB
  • Word/jokes.docx 55.5 kB
  • Word/julian-nivel-1-autoguardado.docx 326.3 kB
  • Word/junk-food-worksheet.docx 590.7 kB
  • Word/just-give-me-a-reason-pink.docx 149.4 kB
  • Word/just-the-way-you-are.docx 74.8 kB
  • Word/just-the-way-you-are_001.docx 293.3 kB
  • Word/justin-bieber-baby.docx 14.7 kB
  • Word/justin-bieber-beauty-and-a-beat.docx 203.8 kB
  • Word/kate-perry.docx 21.7 kB
  • Word/kate-perry_001.docx 46.0 kB
  • Word/kcbs-g6-final-reivew.docx 176.1 kB
  • Word/keep-ya-head-up.docx 20.6 kB
  • Word/kg-math-worksheet-addition.docx 19.1 kB
  • Word/kids-internet-safety-worksheet-26.docx 6.9 kB
  • Word/kitchen-verbs-word-search.docx 198.3 kB
  • Word/knowing.docx 110.1 kB
  • Word/kony-2012-student-sheet.docx 20.7 kB
  • Word/l.docx 263.2 kB
  • Word/lady-gaga-just-dance.docx 13.0 kB
  • Word/lady-gaga.docx 98.5 kB
  • Word/lady-in-red.docx 14.6 kB
  • Word/language-cards.docx 370.1 kB
  • Word/language-functions.docx 13.7 kB
  • Word/last-summer.docx 74.7 kB
  • Word/laura-dekker-video-worksheet.docx 233.3 kB
  • Word/learn-and-practise-passive-voice.docx 38.8 kB
  • Word/leavingonajetplane.docx 167.0 kB
  • Word/legends.docx 137.9 kB
  • Word/leisure-and-hobbies-2011.docx 930.4 kB
  • Word/leisure-flash.docx 3.9 MB
  • Word/lemon-tree.docx 149.5 kB
  • Word/lemon-tree_001.docx 14.1 kB
  • Word/lenka-trouble-is-a-friend.docx 209.4 kB
  • Word/lenka.docx 12.4 kB
  • Word/lenka_everything-at-once.docx 45.9 kB
  • Word/lesson-14-inflections.docx 11.4 kB
  • Word/lesson-2-what-is-a-community.docx 28.1 kB
  • Word/lesson-2-what-is-a-community_001.docx 28.1 kB
  • Word/lesson-6-dream-homes-pictures.docx 505.2 kB
  • Word/lesson-plan-livingnonlivingthings.docx 16.4 kB
  • Word/lesson-reported-speech-worksheet.docx 25.3 kB
  • Word/lesson-warmer-game.docx 16.1 kB
  • Word/lessonplan5.docx 856.5 kB
  • Word/let-it-snow-project-frank-sinatra.docx 803.5 kB
  • Word/lets-go-shopping.docx 78.0 kB
  • Word/letter-bingo.docx 15.8 kB
  • Word/letters-a-i.docx 154.6 kB
  • Word/level_1_conjunction_when1.docx 10.8 kB
  • Word/level_test.docx 16.9 kB
  • Word/life-after-people.docx 2.0 MB
  • Word/life-in-the-15th-century.docx 473.7 kB
  • Word/life-is-a-highway.docx 82.4 kB
  • Word/life-is-wonderful-worksheet.docx 99.1 kB
  • Word/lifestyle-home.docx 138.8 kB
  • Word/lifestyleclubfamily.docx 270.7 kB
  • Word/likes.docx 127.4 kB
  • Word/limits.docx 69.9 kB
  • Word/lines-for-christmast-role-play.docx 21.3 kB
  • Word/linking-2011.docx 162.4 kB
  • Word/linking-words-practice.docx 13.9 kB
  • Word/linking-words.docx 27.2 kB
  • Word/lionel-messi.docx 51.3 kB
  • Word/listening-activity.docx 12.4 kB
  • Word/listening-buying-property.docx 17.7 kB
  • Word/listening-comprehension-intermediate-ii.docx 14.3 kB
  • Word/listening-i-believe-i-can-fly.docx 30.2 kB
  • Word/listening-on-racism.docx 13.5 kB
  • Word/listening-speaking-creepy-crawlies.docx 20.7 kB
  • Word/listening-test-2-10th-form-11-12.docx 367.4 kB
  • Word/listening.docx 13.4 kB
  • Word/literature.docx 18.9 kB
  • Word/little-boxes-song.docx 345.4 kB
  • Word/little-miss-sunshine-take-home-homework.docx 115.5 kB
  • Word/little-red-hen-role-play.docx 18.9 kB
  • Word/little-talks.docx 21.0 kB
  • Word/london-crossword-puzzle.docx 292.3 kB
  • Word/london-word-formation-copy.docx 291.9 kB
  • Word/london.docx 104.7 kB
  • Word/look-at-the-people.docx 123.9 kB
  • Word/look-watch-see-hear-listen.docx 18.4 kB
  • Word/look-watch-see-hear-listen_001.docx 5.4 kB
  • Word/lose-yourself-upper-intermediate.docx 30.8 kB
  • Word/love-actually.docx 105.4 kB
  • Word/love-is-all-around-2.docx 12.1 kB
  • Word/love-of-my-life.docx 13.7 kB
  • Word/love-story-song.docx 17.1 kB
  • Word/love-you-like-a-love-song-selena-gomez.docx 16.2 kB
  • Word/loves-a-many-splendored-thing-activity.docx 752.7 kB
  • Word/luka.docx 16.2 kB
  • Word/lyrics-of-songs.docx 14.2 kB
  • Word/lyrics-to-walking-in-the-air-with-words-taken-out.docx 14.5 kB
  • Word/lyrics-wonderful-tonight.docx 19.3 kB
  • Word/madagascar-2.docx 7.4 MB
  • Word/madagascar-activities-2-infantil-.docx 233.0 kB
  • Word/madlib-personalad.docx 101.3 kB
  • Word/madonna-more.docx 19.0 kB
  • Word/mafalda180s-introduction.docx 126.7 kB
  • Word/magnetic-storm-video-sheet.docx 51.4 kB
  • Word/make-do.docx 650.8 kB
  • Word/make-let-get.docx 68.7 kB
  • Word/make-or-do-text.docx 19.2 kB
  • Word/make-questions.docx 21.1 kB
  • Word/make-the-questions.docx 11.3 kB
  • Word/making-comparisons-copy.docx 174.2 kB
  • Word/making-questions.docx 16.1 kB
  • Word/mama.docx 19.4 kB
  • Word/mamma-mia-lay-all-your-love-on-me.docx 208.3 kB
  • Word/many-faces-of-the-monarch.docx 103.3 kB
  • Word/map.docx 452.6 kB
  • Word/mark-twain-biography-and-exercises.docx 41.5 kB
  • Word/maroon-5-one-more-night.docx 55.0 kB
  • Word/marriage-ceremonies.docx 25.4 kB
  • Word/marry-you-by-bruno-mars.docx 46.1 kB
  • Word/martin-luther-king-full.docx 1.3 MB
  • Word/mary.docx 75.5 kB
  • Word/mary_001.docx 231.6 kB
  • Word/mascots.docx 55.0 kB
  • Word/mass-media-worksheet.docx 15.9 kB
  • Word/masterpiece.docx 75.1 kB
  • Word/match-and-paint-food.docx 77.7 kB
  • Word/matching-sports-upload.docx 259.1 kB
  • Word/material-nouns-2.docx 42.8 kB
  • Word/measures-of-length.docx 17.6 kB
  • Word/media-vocabulary.docx 299.2 kB
  • Word/memory-game-with-phrasal-verbs.docx 11.4 kB
  • Word/memory-game.docx 444.3 kB
  • Word/memory-game_.docx 380.4 kB
  • Word/menu.docx 2.2 MB
  • Word/merry-xmas-evryone.docx 13.0 kB
  • Word/message-a-and-b-roleplay.docx 18.5 kB
  • Word/microsoft-office-word-document.docx 14.1 kB
  • Word/microsoft-office-word-document_001.docx 15.0 kB
  • Word/miles-away-exercicio.docx 12.2 kB
  • Word/miming-for-past-continuous.docx 15.9 kB
  • Word/mind-puzzles.docx 61.5 kB
  • Word/mind-your-language-episodes-1-28.docx 27.0 kB
  • Word/mind-your-language1.docx 122.2 kB
  • Word/mini-story.docx 356.4 kB
  • Word/minimal-pairs-game-reading-paragraphs.docx 28.8 kB
  • Word/miss-you.docx 409.3 kB
  • Word/missing-word-associations-1-students.docx 18.7 kB
  • Word/mistletoe-and-wine-song.docx 15.8 kB
  • Word/mix_condicionals.docx 19.2 kB
  • Word/mix_futur.docx 18.8 kB
  • Word/mix_past.docx 13.1 kB
  • Word/mix_presents.docx 21.4 kB
  • Word/mixed-conditional-life-line.docx 47.7 kB
  • Word/mixed-conditionals.docx 1.0 MB
  • Word/mixed-tenses.docx 60.3 kB
  • Word/mixed-tenses_001.docx 386.6 kB
  • Word/mmshowtheyaremade.docx 280.2 kB
  • Word/modal-verb-notes.docx 25.9 kB
  • Word/modal-verbs-ability.docx 269.2 kB
  • Word/modals.docx 194.2 kB
  • Word/modalshavev3.docx 12.5 kB
  • Word/modern-family-2x08.docx 258.2 kB
  • Word/Modern_Family_worksheet.docx 228.0 kB
  • Word/modes-of-transportation.docx 116.7 kB
  • Word/money-and-finance-vocabulary-activity.docx 12.5 kB
  • Word/money-collocations.docx 24.8 kB
  • Word/money-images-and-vocab.docx 801.8 kB
  • Word/Money_collocations.docx 25.1 kB
  • Word/monster-high.docx 81.2 kB
  • Word/months.docx 14.3 kB
  • Word/most-poisonous-1.docx 739.1 kB
  • Word/mothers-of-the-wild.docx 387.3 kB
  • Word/movie-activity-kung-fu-panda-2.docx 480.1 kB
  • Word/movie-paranorman.docx 637.9 kB
  • Word/mr-bean-at-the-restaurant-video-activity.docx 31.5 kB
  • Word/mr-bean-cards.docx 690.7 kB
  • Word/mr-sandman-articles.docx 11.5 kB
  • Word/mr.docx 14.7 kB
  • Word/mrs-lilia-gammoudi-human-rights.docx 354.7 kB
  • Word/mrs-rich-poor.docx 39.1 kB
  • Word/mrs.docx 41.7 kB
  • Word/mt-2-degrees-of-comparison-worksheets.docx 1.2 MB
  • Word/music-and-lyrics-activities-keys.docx 14.9 kB
  • Word/music-and-mind.docx 15.4 kB
  • Word/music-and-youth-urban-tribes.docx 586.3 kB
  • Word/music-writing-worksheet.docx 142.9 kB
  • Word/musical-instruments.docx 153.4 kB
  • Word/musical-writing.docx 15.7 kB
  • Word/musicians.docx 271.7 kB
  • Word/must-must-be.docx 282.0 kB
  • Word/my-baby-shot-me-down.docx 26.5 kB
  • Word/my-classroom.docx 344.6 kB
  • Word/my-eating-habits.docx 205.6 kB
  • Word/my-favorite-room-writing-prompts.docx 624.3 kB
  • Word/my-name-assignment.docx 341.3 kB
  • Word/na.docx 30.7 kB
  • Word/name-the-following-kinds-of-food.docx 530.5 kB
  • Word/namee-me-5-warming-up-flashcards.docx 1.6 MB
  • Word/names-people-country-alphabet-game.docx 10.7 kB
  • Word/nationality-cards.docx 523.2 kB
  • Word/natural-disasters.docx 360.9 kB
  • Word/natural-disaters-2011.docx 1.1 MB
  • Word/natural-phenomena-boardgame.docx 436.4 kB
  • Word/needed-professinos.docx 385.9 kB
  • Word/negotiation-roleplays.docx 17.5 kB
  • Word/nemo.docx 12.9 kB
  • Word/new-girl.docx 12.7 kB
  • Word/new-microsoft-office-word-document.docx 70.9 kB
  • Word/new-taboo.docx 357.0 kB
  • Word/new-vocabulary_london.docx 229.2 kB
  • Word/new-vocabulary_london_001.docx 232.3 kB
  • Word/new-york-vs-vienna_-comparison.docx 103.9 kB
  • Word/newspaper-headlines.docx 166.6 kB
  • Word/next-2-you-by-chris-brown-feat.docx 195.0 kB
  • Word/next-leader-blank.docx 13.6 kB
  • Word/ng-s01e02.docx 12.7 kB
  • Word/nh-yellow-u14-reported-speech-say-tell.docx 16.6 kB
  • Word/noting-hill-answers-for-questions-sheet.docx 14.5 kB
  • Word/nouns-and-pronouns.docx 14.1 kB
  • Word/nouns-from-adjectives-vocabulary-building.docx 16.3 kB
  • Word/nouns-in-ness.docx 179.3 kB
  • Word/nouns-in-ness_001.docx 18.7 kB
  • Word/nuclear-danger.docx 84.6 kB
  • Word/nuevas-flashcards-what-am-i-game.docx 1.1 MB
  • Word/numbers-2012-elementary.docx 228.5 kB
  • Word/numbers-as-adjectives.docx 120.5 kB
  • Word/numbers-from-0-to-9.docx 134.9 kB
  • Word/numbers.docx 13.4 kB
  • Word/numbers_001.docx 167.5 kB
  • Word/nyl-pre.docx 22.4 kB
  • Word/occupations-with-footer.docx 166.7 kB
  • Word/occupy-wall-street-lesson-plan.docx 15.9 kB
  • Word/oceana.docx 1.1 MB
  • Word/oceans-could-contain-750.docx 33.3 kB
  • Word/office-conversations.docx 28.3 kB
  • Word/office-conversations_1_.docx 28.9 kB
  • Word/ohh-wooaah-ohh-wooaah-ohh-wooaah.docx 184.9 kB
  • Word/ohlamour.docx 15.6 kB
  • Word/old-mcdonald-had-a-farm.docx 175.3 kB
  • Word/olympic-sports-wordsearch.docx 1.0 MB
  • Word/olympics.docx 126.1 kB
  • Word/olympics_001.docx 129.5 kB
  • Word/olympics_002.docx 129.6 kB
  • Word/one-direction-what-makes-you-beautiful.docx 153.8 kB
  • Word/one-headlight.docx 43.7 kB
  • Word/one-life-james-morrison-worksheet.docx 14.7 kB
  • Word/one-love-song-bob-marley.docx 90.5 kB
  • Word/one-of-us.docx 84.7 kB
  • Word/one-repiblic.docx 20.4 kB
  • Word/one-republic-good-life.docx 193.1 kB
  • Word/onions-for-better-health.docx 208.5 kB
  • Word/open-questions-for-esl-teaching.docx 228.5 kB
  • Word/opinion-nl.docx 37.4 kB
  • Word/opis-body.docx 114.3 kB
  • Word/opisanie-komnaty.docx 1.6 MB
  • Word/opposites.docx 182.1 kB
  • Word/oral-composition-ch-1.docx 125.1 kB
  • Word/ordinal-days-months.docx 813.8 kB
  • Word/ought-to-should-beauty.docx 755.8 kB
  • Word/our-family-at-home.docx 182.7 kB
  • Word/our-life-in-seconds.docx 60.9 kB
  • Word/our-solar-system.docx 15.9 kB
  • Word/p-simple-mini.docx 253.7 kB
  • Word/pagan-origins-of-days.docx 1.1 MB
  • Word/pairs-of-wordsandbutor.docx 182.1 kB
  • Word/pairwork.docx 33.4 kB
  • Word/pairwork_elem_unit4.docx 206.9 kB
  • Word/pairworkhouses.docx 2.3 MB
  • Word/pancakes.docx 16.0 kB
  • Word/paperman.docx 16.7 kB
  • Word/paralympics.docx 24.9 kB
  • Word/paraphrase-.docx 38.8 kB
  • Word/partial-translations.docx 21.3 kB
  • Word/participial-phrases.docx 15.8 kB
  • Word/participle-clause-exercisesb.docx 17.7 kB
  • Word/parts-of-a-dress.docx 801.6 kB
  • Word/parts-of-a-jacket.docx 98.0 kB
  • Word/parts-of-a-shirt.docx 160.6 kB
  • Word/parts-of-a-shoe.docx 115.2 kB
  • Word/parts-of-speech-poster.docx 364.8 kB
  • Word/parts-of-the-body.docx 71.5 kB
  • Word/parts-of-the-house.docx 870.7 kB
  • Word/parts-of-the-house_001.docx 44.1 kB
  • Word/parts-of-the-house_002.docx 113.2 kB
  • Word/pasha-parfeny_lautar.docx 44.3 kB
  • Word/pasha-parfeny_lautar_1_.docx 47.2 kB
  • Word/passive-2012.docx 102.0 kB
  • Word/passive-structure.docx 61.1 kB
  • Word/passive-unreal.docx 15.3 kB
  • Word/passive-voice-2012.docx 368.8 kB
  • Word/passive-voice-hurricane-sandy.docx 21.6 kB
  • Word/passive-voice-vs-active-voice-word.docx 29.3 kB
  • Word/passive-voice-worksheet.docx 2.4 MB
  • Word/passive-voice.docx 195.9 kB
  • Word/passive-voice_001.docx 201.6 kB
  • Word/passive-voice_002.docx 25.5 kB
  • Word/passive-voice_003.docx 27.5 kB
  • Word/passive_senior-3fld_quiz_2011.docx 17.8 kB
  • Word/past-continuous-2011.docx 419.0 kB
  • Word/past-participles.docx 155.4 kB
  • Word/past-perfect-continuous.docx 494.1 kB
  • Word/past-perfect-sentences.docx 11.3 kB
  • Word/past-perfect.docx 115.3 kB
  • Word/past-perfect_001.docx 17.3 kB
  • Word/past-perfect_002.docx 115.5 kB
  • Word/past-progressive.docx 29.9 kB
  • Word/past-simple-1.docx 178.1 kB
  • Word/past-simple-2-used-to.docx 247.1 kB
  • Word/past-simple-2-used-to_1_.docx 146.9 kB
  • Word/past-simple-2011.docx 180.7 kB
  • Word/past-simple-and-past-continuous-2012.docx 123.1 kB
  • Word/past-simple-continuous.docx 45.0 kB
  • Word/past-simple-iregular-ii.docx 192.2 kB
  • Word/past-simple-or-continuous.docx 580.1 kB
  • Word/past-simple-or-continuous_001.docx 259.9 kB
  • Word/past-simple-or-continuous_002.docx 16.2 kB
  • Word/past-simple-or-past-continuous.docx 202.7 kB
  • Word/past-simple-or-past-continuous_001.docx 202.7 kB
  • Word/past-simple-practice.docx 85.1 kB
  • Word/past-simple-reg-irr.docx 77.9 kB
  • Word/past-simple-regular-2012.docx 136.6 kB
  • Word/past-simple-regular-2012_001.docx 344.6 kB
  • Word/past-simple-vs-past-continuous-2.docx 16.2 kB
  • Word/past-simple-vs-past-continuous-game.docx 50.4 kB
  • Word/past-simple-vs-past-continuous.docx 127.0 kB
  • Word/past-simple-was-were.docx 136.5 kB
  • Word/past-simple-worksheet.docx 198.5 kB
  • Word/past-simple.docx 15.1 kB
  • Word/past-simple_001.docx 107.5 kB
  • Word/past-tenses-practice.docx 63.0 kB
  • Word/pastmodals.docx 14.5 kB
  • Word/pastry-tools.docx 136.3 kB
  • Word/patience.docx 213.4 kB
  • Word/pearl-jam-last-kiss.docx 12.7 kB
  • Word/penny-gives-sheldon-a-christmas-gift.docx 180.5 kB
  • Word/people-in-my-town.docx 14.7 kB
  • Word/people-say-assume-believe.docx 18.8 kB
  • Word/people.docx 167.4 kB
  • Word/persepolis-ws.docx 143.2 kB
  • Word/personal-8.docx 119.0 kB
  • Word/personal-8_001.docx 125.3 kB
  • Word/personal-characteristics.docx 363.1 kB
  • Word/personal-info-a-and-b.docx 103.2 kB
  • Word/personal-profile.docx 12.9 kB
  • Word/personal-pronoun-y-verb-to-be.docx 16.7 kB
  • Word/personal-pronouns-2011.docx 207.6 kB
  • Word/personal-pronouns-2011_001.docx 216.7 kB
  • Word/personal-robot.docx 176.4 kB
  • Word/personality-adjectives-2012-intermediate.docx 533.8 kB
  • Word/peruvian-animals-4.docx 530.2 kB
  • Word/pet-peeves-discussion-worksheet.docx 59.6 kB
  • Word/phonics-game.docx 548.3 kB
  • Word/phonics-worksheet.docx 395.9 kB
  • Word/phrasal-labyrinth-2.docx 14.1 kB
  • Word/phrasal-labyrinth-2_1_.docx 14.4 kB
  • Word/phrasal-verbs-adv-1-lesson-1.docx 13.3 kB
  • Word/phrasal-verbs-exerciseequivalents-1.docx 17.1 kB
  • Word/phrasal-verbs-solutions-u-int.docx 18.4 kB
  • Word/phrasal-verbs-with-in.docx 177.1 kB
  • Word/phrasal-verbs-with-turn.docx 166.6 kB
  • Word/phrasal-verbs-za-sesti-stepen.docx 56.8 kB
  • Word/phrasal-verbs1.docx 38.2 kB
  • Word/phrasals.docx 16.1 kB
  • Word/physical-appea.docx 13.9 kB
  • Word/picture-story-last-saturday.docx 1.1 MB
  • Word/pirate-mad-lib.docx 44.7 kB
  • Word/places-brighton.docx 321.9 kB
  • Word/places.docx 353.7 kB
  • Word/plan-a-party-speaking-activity.docx 12.7 kB
  • Word/plan.docx 1.6 MB
  • Word/planning-writing.docx 29.0 kB
  • Word/plural-form.docx 117.8 kB
  • Word/plural-nouns.docx 204.4 kB
  • Word/plural-of-nouns.docx 329.7 kB
  • Word/plurals.docx 176.7 kB
  • Word/pollution-word.docx 199.5 kB
  • Word/pollution-word_1_.docx 199.8 kB
  • Word/pop-quiz1.docx 25.7 kB
  • Word/pos-newspaper.docx 36.2 kB
  • Word/possessive-adj.docx 191.2 kB
  • Word/possessive-case-2011.docx 150.0 kB
  • Word/possessive-determiners.docx 152.4 kB
  • Word/postcard-mad-lib.docx 393.8 kB
  • Word/pr-simple-vs-cont.docx 17.0 kB
  • Word/practice-adjectives-and-adverbs.docx 13.4 kB
  • Word/practice.docx 19.8 kB
  • Word/prefix-multiple-choice-b-2.docx 13.4 kB
  • Word/prefixes-int-put-these-adjectives-in-the-correct.docx 78.7 kB
  • Word/prefixes-intelligent-business-revision.docx 15.6 kB
  • Word/prep_quiz.docx 34.2 kB
  • Word/preposition-in-on-at-place-and-time.docx 46.5 kB
  • Word/preposition-quiz.docx 27.1 kB
  • Word/prepositions-bingo.docx 944.5 kB
  • Word/prepositions-intermediate-2012.docx 134.2 kB
  • Word/prepositions-of-location-intro-ball-box-diagrams.docx 15.3 kB
  • Word/prepositions-of-time-2011.docx 489.5 kB
  • Word/prepositions-review.docx 97.1 kB
  • Word/prepositions.docx 287.2 kB
  • Word/prepositions_001.docx 365.2 kB
  • Word/prepositions_002.docx 752.7 kB
  • Word/prepositions_003.docx 93.9 kB
  • Word/prepositionwitch.docx 740.9 kB
  • Word/prepostiions-mini.docx 255.9 kB
  • Word/pres-perf-pr.docx 27.1 kB
  • Word/pres-perf-quiz.docx 13.3 kB
  • Word/pres.docx 19.3 kB
  • Word/present-continuous-2011-2.docx 235.9 kB
  • Word/present-continuous-or-present-simple-1.docx 26.7 kB
  • Word/present-continuous-or-present-simple.docx 23.8 kB
  • Word/present-continuous-revision-table.docx 14.8 kB
  • Word/present-continuous.docx 306.7 kB
  • Word/present-participle-copy-1.docx 18.6 kB
  • Word/present-perfect-bingo.docx 11.7 kB
  • Word/present-perfect-continuous-2011.docx 299.0 kB
  • Word/present-perfect-continuous.docx 154.0 kB
  • Word/present-perfect-drills-elementary.docx 18.1 kB
  • Word/present-perfect-exercise-1.docx 13.8 kB
  • Word/present-perfect-for-beginners.docx 129.0 kB
  • Word/present-perfect-past-perfect-past-simple.docx 274.5 kB
  • Word/present-perfect-simple-vs-continuous.docx 18.0 kB
  • Word/present-perfect-x-simple-past.docx 23.2 kB
  • Word/present-perfect.docx 260.3 kB
  • Word/present-perfect_001.docx 35.6 kB
  • Word/present-simple-04.docx 287.6 kB
  • Word/present-simple-a.docx 359.3 kB
  • Word/present-simple-affirmative-i.docx 216.1 kB
  • Word/present-simple-affirmative.docx 37.4 kB
  • Word/present-simple-continuous-t-1.docx 87.1 kB
  • Word/present-simple-find-and-correct-the-mistakes.docx 88.8 kB
  • Word/present-simple-in-polish-konstrucja.docx 11.6 kB
  • Word/present-simple-interrogative.docx 183.9 kB
  • Word/present-simple-or-continuous.docx 172.7 kB
  • Word/present-simple-or-continuous_001.docx 19.2 kB
  • Word/present-simple-or-continuous_002.docx 386.0 kB
  • Word/present-simple-overview.docx 14.4 kB
  • Word/present-simple-practice-21y2-autoguardado.docx 20.7 kB
  • Word/present-simple-questions-with-no-auxiliary-no-do.docx 14.7 kB
  • Word/present-simple-sep.docx 211.8 kB
  • Word/present-simple-vs-continuous.docx 16.8 kB
  • Word/present-simple-vs-present-continuous-acabar.docx 26.8 kB
  • Word/present-simple-vs-present-continuous-chart.docx 16.2 kB
  • Word/present-simple-vs-present-continuous-sep2011.docx 99.8 kB
  • Word/present-simple-vs-present-continuous.docx 449.6 kB
  • Word/present-simple-vs-present-continuous_001.docx 14.9 kB
  • Word/present-simple-vs-present-continuous_002.docx 14.9 kB
  • Word/present-simple-vs.docx 486.3 kB
  • Word/present-simple.docx 13.8 kB
  • Word/present-tenses-general.docx 20.7 kB
  • Word/present-tenses.docx 12.8 kB
  • Word/present-times.docx 15.8 kB
  • Word/present_progressive_fools_garden_lemon_tree.docx 20.6 kB
  • Word/Present_Simple.docx 1.4 MB
  • Word/presentation-too-vs-enough.docx 112.1 kB
  • Word/presentations.docx 16.8 kB
  • Word/presentmodals.docx 18.4 kB
  • Word/presentpastpprogressivespeakingreview.docx 11.5 kB
  • Word/presentsimple-exercise.docx 17.4 kB
  • Word/presentsimpletense.docx 35.7 kB
  • Word/preserving-our-planet.docx 149.1 kB
  • Word/president.docx 206.8 kB
  • Word/presn-simple.docx 13.6 kB
  • Word/prettywoman_scene.docx 18.1 kB
  • Word/price-dictation-ws21-2.docx 13.5 kB
  • Word/pride-prejudice-student-version.docx 129.2 kB
  • Word/primarystartersgoingtomoversactivities.docx 397.7 kB
  • Word/printables_-7-september_1_.docx 64.7 kB
  • Word/product-questions.docx 11.5 kB
  • Word/proffessions.docx 23.3 kB
  • Word/profile-page_lesson-1.docx 73.3 kB
  • Word/Programmation_HIVER_2013-3e_Cohorte_1_.docx 24.0 kB
  • Word/project-management-explained-simply.docx 242.9 kB
  • Word/pronoun-dice-with-pos-neg-and-ques.docx 606.3 kB
  • Word/pronouns-text.docx 12.7 kB
  • Word/pronun.docx 11.5 kB
  • Word/pronunciation-of-numbers.docx 89.5 kB
  • Word/propositions-of-place.docx 208.3 kB
  • Word/proverbs.docx 19.2 kB
  • Word/ps-vs-pc-2011.docx 301.0 kB
  • Word/public-places-1.docx 552.8 kB
  • Word/pulled-over-for-speeding.docx 14.8 kB
  • Word/punctuation.docx 14.6 kB
  • Word/puss-in-boots.docx 1.0 MB
  • Word/quantifiers-2011.docx 62.7 kB
  • Word/quantifiers-2011_001.docx 83.2 kB
  • Word/quantifiers.docx 267.5 kB
  • Word/questio1.docx 760.4 kB
  • Word/question-cards.docx 1.6 MB
  • Word/question-review-pres-past-fut.docx 19.9 kB
  • Word/question-tags-1.docx 91.8 kB
  • Word/question-tags.docx 45.2 kB
  • Word/question-tags_001.docx 12.4 kB
  • Word/question-word.docx 140.8 kB
  • Word/questions-2011.docx 33.9 kB
  • Word/questions-and-answers.docx 11.9 kB
  • Word/questions-game.docx 57.8 kB
  • Word/questions-in-the-bag.docx 13.5 kB
  • Word/questions-mini.docx 87.0 kB
  • Word/questions-tags-m.docx 116.6 kB
  • Word/questions.docx 41.8 kB
  • Word/questions_001.docx 13.8 kB
  • Word/questions_002.docx 14.5 kB
  • Word/questions_003.docx 15.7 kB
  • Word/questions_exercises.docx 26.0 kB
  • Word/questions_game_corrected_file.docx 14.5 kB
  • Word/questions_grammar-guide.docx 41.2 kB
  • Word/questonsss.docx 69.4 kB
  • Word/quick-as-a-cricket.docx 55.8 kB
  • Word/quick-reminder.docx 19.4 kB
  • Word/quiz-a.docx 20.6 kB
  • Word/quiz-t1.docx 13.5 kB
  • Word/quotations.docx 28.3 kB
  • Word/rachael-yamagata-i-dont-want-to-be-your-mother.docx 12.0 kB
  • Word/rachel-and-phoebe-literature-class.docx 21.0 kB
  • Word/rain.docx 17.8 kB
  • Word/rainforest-facts.docx 67.6 kB
  • Word/rapunzel.docx 21.9 kB
  • Word/ratatouille-activity.docx 22.0 kB
  • Word/ratatouille-movie.docx 728.7 kB
  • Word/ratatouille-movie_001.docx 1.0 MB
  • Word/rdgpctwwwwwh.docx 71.6 kB
  • Word/read-and-colour.docx 446.4 kB
  • Word/read-the-text-about-sky-court.docx 7.2 MB
  • Word/reading-activity-bed-bugs.docx 218.3 kB
  • Word/reading-activity-dog-causes-fire.docx 302.6 kB
  • Word/reading-activity-firing.docx 234.6 kB
  • Word/reading-activity-texting.docx 218.3 kB
  • Word/reading-and-grammar-past-tense-review.docx 67.6 kB
  • Word/reading-comprehension-jessie-and-tom.docx 115.6 kB
  • Word/reading-comprehension-jessie-and-tom_001.docx 106.7 kB
  • Word/reading-comprehension-music-7th.docx 23.5 kB
  • Word/reading-comprehension-selfesteem8th.docx 19.3 kB
  • Word/reading-comprehension-upper-intermediated.docx 18.6 kB
  • Word/reading-comprehension-work-jobs.docx 30.2 kB
  • Word/reading-comprehension.docx 39.5 kB
  • Word/reading-comprehension_001.docx 16.9 kB
  • Word/reading-family.docx 46.2 kB
  • Word/reading-family_001.docx 47.5 kB
  • Word/reading-gb.docx 17.9 kB
  • Word/reading-practice.docx 11.3 kB
  • Word/reading-tasks.docx 15.3 kB
  • Word/reading-usa-elections-2012.docx 238.3 kB
  • Word/reading-voc-obesityhealthfat-food.docx 31.8 kB
  • Word/reading.docx 20.8 kB
  • Word/reading_agriculture_what-to-do-about-lead.docx 34.1 kB
  • Word/real-conversation-questions.docx 15.1 kB
  • Word/reasons-to-believe.docx 17.3 kB
  • Word/recipes.docx 201.8 kB
  • Word/references.docx 144.9 kB
  • Word/regular.docx 1.8 MB
  • Word/rehab.docx 442.2 kB
  • Word/relationships-1.docx 16.2 kB
  • Word/relative-clauses-paragraph-with-gap-fill.docx 21.7 kB
  • Word/relative-clauses.docx 12.3 kB
  • Word/relative-clauses_001.docx 13.7 kB
  • Word/relative-clauses_002.docx 12.8 kB
  • Word/relative-clauses_003.docx 10.9 kB
  • Word/relative-clauses_004.docx 220.6 kB
  • Word/relative-pronouns-2.docx 53.6 kB
  • Word/remember.docx 228.2 kB
  • Word/rep-speech-forth-and-back.docx 41.9 kB
  • Word/reported-practice.docx 14.4 kB
  • Word/reported-speech-12.docx 203.7 kB
  • Word/reported-speech-2012.docx 95.7 kB
  • Word/reported-speech-english.docx 14.4 kB
  • Word/reported-speech.docx 511.3 kB
  • Word/reported-speech_001.docx 15.9 kB
  • Word/reported-speech_002.docx 33.0 kB
  • Word/reported-statements-and-questions.docx 20.4 kB
  • Word/reported_speech10th2011.docx 102.5 kB
  • Word/repoted-speech.docx 21.1 kB
  • Word/Repoted_Speech.docx 21.3 kB
  • Word/Repoted_Speech_001.docx 21.5 kB
  • Word/restaurant-role-play.docx 51.5 kB
  • Word/result-_-201-_-unit-1-wh-.docx 13.4 kB
  • Word/review-8-th-form-9th-form-pronunciation-sep-2010.docx 66.2 kB
  • Word/review-exercises.docx 121.4 kB
  • Word/review-nl.docx 328.4 kB
  • Word/review-tenses.docx 53.5 kB
  • Word/revising-tenses-past-continuous.docx 433.7 kB
  • Word/revising-tenses-present-simple.docx 113.8 kB
  • Word/revising-verb-tenses-present-continuous.docx 167.9 kB
  • Word/revising-verb-tenses-present-simple-vs-present.docx 125.3 kB
  • Word/revision-7.docx 14.3 kB
  • Word/revision-exercise-personal-pronouns.docx 12.2 kB
  • Word/revision-for-class-8-future.docx 19.7 kB
  • Word/revision-presentpast-simple-continuous-adjectives.docx 83.1 kB
  • Word/revision-tree-tops-3-practice-2-feb-2012.docx 463.9 kB
  • Word/rhyming-pais.docx 414.5 kB
  • Word/riddles.docx 23.4 kB
  • Word/robbery.docx 20.4 kB
  • Word/robert-palmer.docx 13.4 kB
  • Word/robin-hood.docx 123.5 kB
  • Word/rockabilly-is-cool.docx 149.6 kB
  • Word/role-play-complaint.docx 16.2 kB
  • Word/role-play-famous-people.docx 1.3 MB
  • Word/role-play-famous-people_001.docx 900.0 kB
  • Word/role-play.docx 14.1 kB
  • Word/rolling-in-the-deep-adele.docx 17.1 kB
  • Word/rolling-in-the-deep.docx 15.7 kB
  • Word/rome.docx 160.9 kB
  • Word/rooms-at-the-top.docx 14.7 kB
  • Word/rooms-in-the-house.docx 817.7 kB
  • Word/rosa-parks.docx 27.4 kB
  • Word/rosaparks_original.docx 51.1 kB
  • Word/rosi-golan-conditionals-type-2.docx 108.9 kB
  • Word/routines.docx 13.6 kB
  • Word/rowan-atkinsons-biography.docx 60.7 kB
  • Word/rowan-atkinsons-biography_001.docx 60.1 kB
  • Word/roxette.docx 106.8 kB
  • Word/royal-family.docx 94.4 kB
  • Word/Rudolph_the_Red_Nose_Reindeer.docx 24.3 kB
  • Word/rules-for-adding-suffixes-to-root-words.docx 30.2 kB
  • Word/s._past-used_to-would.docx 23.4 kB
  • Word/s.docx 23.4 kB
  • Word/s2.docx 152.9 kB
  • Word/said-i-love-u-but-i-lied.docx 12.8 kB
  • Word/salad-vegetable-vocabulary-test.docx 158.5 kB
  • Word/salad-vegetables-flashcards.docx 156.6 kB
  • Word/san-fermin-1.docx 12.0 kB
  • Word/san-francisco-story.docx 621.7 kB
  • Word/sandwich.docx 4.6 MB
  • Word/santa-claus-is-coming-to-town-hl.docx 60.2 kB
  • Word/santana.docx 49.5 kB
  • Word/sara-is-a-scientist.docx 473.7 kB
  • Word/satellite-worksheet.docx 97.6 kB
  • Word/say-tell-speak-and-talk.docx 52.3 kB
  • Word/say-tell-speak-talk-theory.docx 31.9 kB
  • Word/scavenger-hunt.docx 27.8 kB
  • Word/school-objects.docx 230.8 kB
  • Word/school-rooms-there-to-be.docx 66.8 kB
  • Word/school-subjects-2011.docx 125.2 kB
  • Word/school-supplies-match-words.docx 939.3 kB
  • Word/school-things.docx 2.3 MB
  • Word/school.docx 60.1 kB
  • Word/scotland.docx 62.4 kB
  • Word/scramble.docx 29.7 kB
  • Word/script-videojug-mayonnaise.docx 229.9 kB
  • Word/se7en.docx 16.7 kB
  • Word/seasons-of-the-year.docx 255.4 kB
  • Word/second-conditional-2011.docx 440.6 kB
  • Word/second-conditional.docx 21.7 kB
  • Word/second-term-exam-ms-4-march-2012.docx 359.2 kB
  • Word/second-term-test-2-for-ms4-feb-2011.docx 269.4 kB
  • Word/second-term-test-2-ms-3-feb-2011.docx 340.2 kB
  • Word/secrets-of-a-happy-marriage.docx 16.6 kB
  • Word/self-sacrifice.docx 53.8 kB
  • Word/selling-ice-to-eskimos.docx 16.8 kB
  • Word/selling-skills-roleplay-1.docx 14.0 kB
  • Word/sentence-building.docx 82.1 kB
  • Word/sentence-transformation-1.docx 15.8 kB
  • Word/sentence-transformation-present-perfect-past.docx 11.6 kB
  • Word/sentence.docx 15.7 kB
  • Word/senyum.docx 323.0 kB
  • Word/set-fire-to-the-rain-preparar-atividade.docx 282.6 kB
  • Word/set-fire-to-the-rain.docx 159.3 kB
  • Word/set-fire-to-the-rain_001.docx 142.5 kB
  • Word/sexthe-city-video-worksheet.docx 2.4 MB
  • Word/shake-it-out.docx 15.0 kB
  • Word/shake-up-christmas.docx 16.9 kB
  • Word/shall.docx 223.4 kB
  • Word/shall_001.docx 245.2 kB
  • Word/shambo.docx 13.1 kB
  • Word/shape-name-matching-h.docx 41.9 kB
  • Word/shapes-and-colors.docx 474.2 kB
  • Word/shapes-bingo.docx 52.0 kB
  • Word/she-was-the-one-robbie-willians.docx 14.5 kB
  • Word/she-will-be-loved-maroon-5.docx 101.4 kB
  • Word/sheldon-cooper-2.docx 172.8 kB
  • Word/sherlock-holmes-trailer.docx 24.7 kB
  • Word/shine-bright-like-a-diamond.docx 15.0 kB
  • Word/shopping-in-england.docx 60.8 kB
  • Word/shopping-treasure-hunt.docx 812.8 kB
  • Word/short-answers.docx 22.8 kB
  • Word/short-answers2.docx 15.1 kB
  • Word/short-film-past-tense.docx 39.6 kB
  • Word/short-test-relative-pronouns-ninth.docx 15.3 kB
  • Word/should-ought-to.docx 17.9 kB
  • Word/show-must-go-on.docx 21.6 kB
  • Word/showing-surprise-and-interest.docx 14.9 kB
  • Word/simdiki-zaman-chores.docx 323.0 kB
  • Word/similes.docx 34.2 kB
  • Word/simple-future-dictation.docx 13.8 kB
  • Word/simple-math-song.docx 19.9 kB
  • Word/simple-past-abc.docx 21.5 kB
  • Word/simple-past-tense-vs-past-cont.docx 24.6 kB
  • Word/simple-past-tense-vs-past-cont_001.docx 27.9 kB
  • Word/simple-past-tense-vs-past-continuous.docx 43.5 kB
  • Word/simple-past-tense-vs-past-continuous_001.docx 42.1 kB
  • Word/simple-past-to-be-2011.docx 284.7 kB
  • Word/simple-past-vs-present-perfect.docx 76.4 kB
  • Word/simple-past.docx 32.8 kB
  • Word/simple-pres-vs-pres-cont.docx 39.8 kB
  • Word/simple-present-and-present-continuous-olympics.docx 31.4 kB
  • Word/simple-present-exercises.docx 27.6 kB
  • Word/simple-present-tense-review.docx 8.4 MB
  • Word/simple-present-tense-sentenses.docx 15.5 kB
  • Word/simple-present-tense-workshop.docx 11.5 kB
  • Word/simple-present-vs-present-continuous.docx 31.1 kB
  • Word/simple-present.docx 14.0 kB
  • Word/simple-vocabulary-test-verbs.docx 250.4 kB
  • Word/Simple_Present_Tense_workshop.docx 11.5 kB
  • Word/Simple_Present_Tense_workshop_001.docx 11.5 kB
  • Word/simpsons-peresent-cont.docx 178.2 kB
  • Word/simpsons-worksheet.docx 1.8 MB
  • Word/singular-plural.docx 143.6 kB
  • Word/singular.docx 151.7 kB
  • Word/skazka-o-sobakax.docx 12.9 kB
  • Word/skyfall-lyrics.docx 29.4 kB
  • Word/slidesword-doc.docx 4.0 kB
  • Word/slimy-sandwiches.docx 153.1 kB
  • Word/smoking-vocabulary-exercise.docx 13.3 kB
  • Word/smurf.docx 285.0 kB
  • Word/snakes-and-ladders.docx 766.0 kB
  • Word/snowwhite.docx 97.9 kB
  • Word/so-far-away-avenged-sevenfold.docx 16.8 kB
  • Word/so-what-listening.docx 85.5 kB
  • Word/soil-n-noise-practice.docx 193.8 kB
  • Word/solidarity.docx 96.8 kB
  • Word/solving-scenarios.docx 27.5 kB
  • Word/some-adjectives-and-their-opposites.docx 17.0 kB
  • Word/some-any-no-2012.docx 107.2 kB
  • Word/some-any.docx 1.3 MB
  • Word/somebody-i-used-to-know-lyrics.docx 13.9 kB
  • Word/somebody-that-i-used-to-know-timeline-story.docx 59.6 kB
  • Word/somebody-to-love-song-activity.docx 13.7 kB
  • Word/someone-like-you-by-adele.docx 100.5 kB
  • Word/something-that-takes-money-to-do.docx 15.5 kB
  • Word/somewhere-only.docx 69.1 kB
  • Word/somewhere-over-the-rainbow-exercise.docx 166.8 kB
  • Word/song-activity-bi.docx 18.3 kB
  • Word/song-activity-days-of-the-week-friday-i-am-in.docx 24.3 kB
  • Word/song-activity-destinys-child-survivor.docx 49.6 kB
  • Word/song-bohemiun-like-you-pres-simple-and-progressive.docx 17.1 kB
  • Word/song-by-u2.docx 18.8 kB
  • Word/song-lyric-running-dictation-and-competition.docx 99.6 kB
  • Word/song-lyrics-activities-times-like-these-by-jack.docx 16.6 kB
  • Word/song-lyrics-count-on-me.docx 15.8 kB
  • Word/song-madonna-uncountable.docx 276.2 kB
  • Word/song-mother-john-lennon-past-tense-level-beginner.docx 13.2 kB
  • Word/song-pitbull.docx 18.1 kB
  • Word/song.docx 70.2 kB
  • Word/songworksheet-the-cure-lovesong.docx 56.6 kB
  • Word/soulsister.docx 37.4 kB
  • Word/soulsister_001.docx 34.5 kB
  • Word/south-korea-to-swap-textbooks-for-tablets.docx 15.1 kB
  • Word/speaking-activity-1.docx 15.1 kB
  • Word/speaking-activity-2.docx 13.0 kB
  • Word/speaking-activity-3.docx 16.9 kB
  • Word/speaking-activity-learning-english.docx 125.6 kB
  • Word/speaking-board-game.docx 812.4 kB
  • Word/Speaking_Activity_3.docx 16.7 kB
  • Word/Speaking_Activity_3_001.docx 17.9 kB
  • Word/spelling-game.docx 417.0 kB
  • Word/spending-my-time-by-roxette.docx 14.0 kB
  • Word/sport-game.docx 312.9 kB
  • Word/sports-can-likes-and-dislikes.docx 36.4 kB
  • Word/sports-flash-011.docx 469.1 kB
  • Word/sports-matching-2012.docx 278.5 kB
  • Word/sports-msing.docx 480.4 kB
  • Word/sports-pictionary.docx 284.3 kB
  • Word/sports.docx 196.9 kB
  • Word/sports_001.docx 78.8 kB
  • Word/spring-2012.docx 191.2 kB
  • Word/spring-flowers-harbingers-of-spring.docx 711.1 kB
  • Word/spring.docx 171.4 kB
  • Word/st-valentines-wordsearch.docx 672.8 kB
  • Word/stand-by-me-activity.docx 11.0 kB
  • Word/star-of-the-month.docx 267.0 kB
  • Word/starter-unit-test.docx 90.4 kB
  • Word/stencils_matching.docx 561.6 kB
  • Word/stereo-hearts-gym-class-heroes-ft-adam-levine.docx 149.1 kB
  • Word/still-loving-you.docx 15.5 kB
  • Word/sting.docx 13.5 kB
  • Word/story-time.docx 642.1 kB
  • Word/story.docx 94.2 kB
  • Word/stranger-by-the-day-corrected.docx 12.6 kB
  • Word/stuck-in-a-moment.docx 69.6 kB
  • Word/student-crossword.docx 297.5 kB
  • Word/student-home-work-worksheet-number-names-term-1.docx 11.7 kB
  • Word/subj-verb.docx 19.3 kB
  • Word/Subj-Verb_001.docx 127.4 kB
  • Word/subject-pronouns.docx 178.8 kB
  • Word/subjunctive-mood.docx 20.4 kB
  • Word/summer-holidays.docx 15.6 kB
  • Word/summer-paradise.docx 22.4 kB
  • Word/summer-schoo-test-types-of-sentences.docx 17.5 kB
  • Word/summer-worksheet-moi.docx 13.4 kB
  • Word/sunlight-by-the-4-of-us.docx 14.0 kB
  • Word/superhero-supermad-lib.docx 48.3 kB
  • Word/suzanne-vega-task.docx 229.9 kB
  • Word/symbols.docx 111.2 kB
  • Word/synonym-and-antonym-worksheet.docx 17.0 kB
  • Word/synonyms-and-antonyms.docx 144.3 kB
  • Word/t-t-1.docx 77.6 kB
  • Word/taboo.docx 15.6 kB
  • Word/taboo2.docx 13.4 kB
  • Word/taboo3.docx 14.1 kB
  • Word/taboo3_001.docx 14.1 kB
  • Word/taboo_001.docx 26.9 kB
  • Word/taboo_002.docx 27.0 kB
  • Word/tag-questions.docx 22.8 kB
  • Word/talk-to-your-partner.docx 13.3 kB
  • Word/talking-about-abilities-in-english.docx 789.8 kB
  • Word/talking-about-events-in-the-past.docx 44.6 kB
  • Word/talking-about-family.docx 228.2 kB
  • Word/talking-about-past-actions-2011.docx 178.1 kB
  • Word/talking-about-your-eating-habits.docx 144.1 kB
  • Word/taller-1.docx 14.0 kB
  • Word/tarot.docx 1.7 MB
  • Word/task-2_aya.docx 16.3 kB
  • Word/tasks-for-seasons-of-giving.docx 13.3 kB
  • Word/taylor-swiff-song.docx 92.4 kB
  • Word/tb1back-to-school.docx 476.4 kB
  • Word/teachers.docx 128.6 kB
  • Word/teacherspage.docx 17.1 kB
  • Word/teaching-esl-students-about-the-12-days-of.docx 12.1 kB
  • Word/technical-equipment-have-got.docx 522.2 kB
  • Word/technology-robot-boy.docx 192.6 kB
  • Word/teddy-bear.docx 45.9 kB
  • Word/teen-stars-love-dogs-bt.docx 347.5 kB
  • Word/Teen_Stars_Love_Dogs_BT.docx 347.8 kB
  • Word/Teen_Stars_Love_Dogs_BT_001.docx 295.7 kB
  • Word/teenage-dirtbag.docx 241.2 kB
  • Word/teenwolfs1e1.docx 149.0 kB
  • Word/telephone-phrasal-verbs.docx 14.9 kB
  • Word/telephone-roleplays.docx 15.5 kB
  • Word/telephoneroleplay-cards-names-and-numbers.docx 13.2 kB
  • Word/television-adverts-worksheet.docx 14.8 kB
  • Word/tell-me-why.docx 390.7 kB
  • Word/tell-your-friend-about-your-problems-and-let-him.docx 13.7 kB
  • Word/telling-time-and-daily-activities.docx 11.3 kB
  • Word/ten-little-indians.docx 165.1 kB
  • Word/tense-blender.docx 361.9 kB
  • Word/tense-revision-betting-game.docx 29.7 kB
  • Word/tenses-review-with-verb-to-be-and-timeline.docx 176.5 kB
  • Word/tenses-structure.docx 119.4 kB
  • Word/tenses-worksheet.docx 12.4 kB
  • Word/tenses.docx 13.6 kB
  • Word/terror-at-sea.docx 22.6 kB
  • Word/test-1.docx 132.0 kB
  • Word/test-2-kl.docx 1.1 MB
  • Word/test-5-module-6-grade.docx 24.0 kB
  • Word/test-ee.docx 253.7 kB
  • Word/test-for-3-grades.docx 346.4 kB
  • Word/test-for-b1-tues.docx 114.0 kB
  • Word/test-for-halloween.docx 13.6 kB
  • Word/test-of-irregular-verbs.docx 17.9 kB
  • Word/test-on-quantifiers.docx 16.1 kB
  • Word/test-school-and-friends.docx 310.4 kB
  • Word/test-that-determines-the-level-of-the-student.docx 14.9 kB
  • Word/test-vi-imperative-can.docx 15.3 kB
  • Word/test-your-simple-past-tense.docx 13.1 kB
  • Word/test.docx 689.1 kB
  • Word/test_001.docx 1.9 MB
  • Word/test_oct8.docx 496.5 kB
  • Word/teste-daily-routine-6deb.docx 102.5 kB
  • Word/teste-de-6.docx 183.4 kB
  • Word/tgif.docx 16.7 kB
  • Word/thanksgiving-wordsearch.docx 106.1 kB
  • Word/that-must-be-have-to-dont-have-to-activities.docx 14.2 kB
  • Word/the-abc-for-a-great-year.docx 152.2 kB
  • Word/the-abc-song.docx 31.8 kB
  • Word/the-art-teacher.docx 156.4 kB
  • Word/the-beauty-of-zen.docx 43.3 kB
  • Word/the-best.docx 103.8 kB
  • Word/the-birth-of-jesus.docx 223.4 kB
  • Word/the-blind-side-movie-useful-worksheet.docx 97.9 kB
  • Word/the-capital-of-britain-is.docx 14.4 kB
  • Word/the-day-of-the-wheel.docx 1.5 MB
  • Word/the-days-of-the-week.docx 2.9 MB
  • Word/the-discovery-of-america.docx 231.6 kB
  • Word/the-edpronunciationrules.docx 7.5 kB
  • Word/the-family.docx 119.8 kB
  • Word/the-first-conditional-matching.docx 87.5 kB
  • Word/the-first-time.docx 13.0 kB
  • Word/the-great-pretender.docx 71.1 kB
  • Word/the-greatest-treasure.docx 13.7 kB
  • Word/the-hanging-gardens.docx 927.6 kB
  • Word/the-hardest-language-to-learn.docx 13.8 kB
  • Word/the-hobbit.docx 89.6 kB
  • Word/the-hungry-generation.docx 145.9 kB
  • Word/the-jeely-piece-song.docx 19.0 kB
  • Word/the-killers-mr-brightside-present-continuous-with.docx 16.8 kB
  • Word/the-killers-somebody-told-me.docx 17.2 kB
  • Word/the-lake-district.docx 50.3 kB
  • Word/the-legend-of-nessie.docx 170.6 kB
  • Word/the-legend-original.docx 1.7 MB
  • Word/the-logical-song-supertramp.docx 57.5 kB
  • Word/the-logical-song.docx 117.0 kB
  • Word/the-london-olympics.docx 89.0 kB
  • Word/the-lost-world.docx 587.8 kB
  • Word/the-luck-child.docx 66.5 kB
  • Word/the-man-booker-prize.docx 14.5 kB
  • Word/the-one-that-got-away.docx 12.6 kB
  • Word/the-passive-voice.docx 22.4 kB
  • Word/the-passive-voice_001.docx 22.7 kB
  • Word/the-past-continuousthe-past-perfect-and-the-past.docx 19.4 kB
  • Word/the-past-simple-negative.docx 148.5 kB
  • Word/the-plural-poem.docx 13.8 kB
  • Word/the-polar-express.docx 115.8 kB
  • Word/the-present-simple.docx 77.4 kB
  • Word/the-pretender-worksheet-verb-to-be.docx 18.2 kB
  • Word/the-prince-and-the-showgirl.docx 917.7 kB
  • Word/the-proposal-present-continuous.docx 655.7 kB
  • Word/the-queen.docx 281.6 kB
  • Word/the-schwa.docx 22.6 kB
  • Word/the-simple-present-yes-no-questions.docx 13.3 kB
  • Word/the-someday-list.docx 14.2 kB
  • Word/the-sorcerers-apprentice-1.docx 1.9 MB
  • Word/the-spelling-song.docx 82.9 kB
  • Word/the-statue-of-zeus.docx 85.5 kB
  • Word/the-tale-of-the-three-brothers-handout.docx 77.0 kB
  • Word/the-tiniest-flower.docx 2.5 MB
  • Word/the-tunnel.docx 22.4 kB
  • Word/the-twins-of-siam.docx 62.2 kB
  • Word/the-twins-of-siam_001.docx 62.5 kB
  • Word/the-two-towers.docx 33.6 kB
  • Word/the-union-jack.docx 45.6 kB
  • Word/the-united-kingdom.docx 131.2 kB
  • Word/the-very-hungry-caterpillar.docx 401.1 kB
  • Word/the-voice-lesson.docx 109.7 kB
  • Word/the-weather.docx 126.2 kB
  • Word/the-wheels-on-the-bus.docx 133.3 kB
  • Word/the-zx-spectrum.docx 13.1 kB
  • Word/the_usa_matching-pairs.docx 13.0 kB
  • Word/theatre-terms-matching.docx 113.7 kB
  • Word/theme-and-mood-unit-2.docx 15.0 kB
  • Word/then-and-now.docx 1.3 MB
  • Word/theory-time-in-english.docx 192.9 kB
  • Word/there-is-there-are.docx 384.3 kB
  • Word/there-is-there-are_001.docx 233.2 kB
  • Word/there-is.docx 15.7 kB
  • Word/there-to-be.docx 15.0 kB
  • Word/there.docx 17.4 kB
  • Word/thesecretcircles1e1-1.docx 159.9 kB
  • Word/thesecretcircles1e1.docx 159.9 kB
  • Word/things-in-house.docx 133.8 kB
  • Word/things-to-do-in-brighton-text-and-questions.docx 13.0 kB
  • Word/third-conditional-ii.docx 87.5 kB
  • Word/third-conditional-review-and-drills.docx 32.6 kB
  • Word/third-term-exam-ms1-may-2011.docx 31.7 kB
  • Word/third-term-exam-ms4-may-2011.docx 85.6 kB
  • Word/third-term-test-1-for-ms1-april-2011.docx 90.9 kB
  • Word/third-term-test-1-ms-3-april-2011.docx 277.4 kB
  • Word/third-term-test-1-ms4-april-2011.docx 150.4 kB
  • Word/this-is-a-song-from-an-oscar-award-winning-film.docx 20.3 kB
  • Word/tiger.docx 80.5 kB
  • Word/tigers.docx 240.9 kB
  • Word/time-clauses-ok.docx 140.6 kB
  • Word/time-expressions.docx 68.2 kB
  • Word/time-for-a-movie-eye-of-the-beholder.docx 79.0 kB
  • Word/time-for-a-movie-eye-of-the-beholder_001.docx 80.7 kB
  • Word/time-prepositions-and-time-expressions.docx 133.0 kB
  • Word/time-travel-discussion.docx 952.8 kB
  • Word/time.docx 153.3 kB
  • Word/time1.docx 168.0 kB
  • Word/time_001.docx 60.3 kB
  • Word/timetable.docx 12.0 kB
  • Word/timi-practice2.docx 73.5 kB
  • Word/tinkers-island-is-a-fictional-story.docx 351.5 kB
  • Word/tips-on-ecpe.docx 24.0 kB
  • Word/title-page-for-ils.docx 366.0 kB
  • Word/to-be-04-2011.docx 109.1 kB
  • Word/to-be-12.docx 68.3 kB
  • Word/to-be-2011-reading.docx 135.5 kB
  • Word/to-be-bookmarks.docx 104.3 kB
  • Word/to-be-game.docx 72.8 kB
  • Word/to-be-iii.docx 1.3 MB
  • Word/to-be-interrogative.docx 165.0 kB
  • Word/to-be-mini.docx 130.3 kB
  • Word/to-be-negative.docx 350.6 kB
  • Word/to-be-uploaded.docx 15.1 kB
  • Word/to-be.docx 190.9 kB
  • Word/to-be_001.docx 171.9 kB
  • Word/to-have-got.docx 688.3 kB
  • Word/to-really-love-a-woman.docx 16.6 kB
  • Word/toby-keith.docx 286.7 kB
  • Word/today-is-my-birthday.docx 57.5 kB
  • Word/tom-and-the-dinosaur.docx 637.4 kB
  • Word/tongue-twisters-in-abc-order.docx 29.2 kB
  • Word/tongue-twisters.docx 30.1 kB
  • Word/tonight.docx 17.2 kB
  • Word/toys-crossword.docx 197.7 kB
  • Word/traditionsorganizer.docx 20.9 kB
  • Word/transp.docx 391.8 kB
  • Word/transportation-role-cards.docx 13.8 kB
  • Word/travel-vocabulary.docx 27.4 kB
  • Word/travelling.docx 353.3 kB
  • Word/travelling_001.docx 24.8 kB
  • Word/travis.docx 103.5 kB
  • Word/trees.docx 766.7 kB
  • Word/tweety-telling-the-time.docx 120.2 kB
  • Word/ukvisas.docx 41.0 kB
  • Word/unbreak-my-heart-toni-braxton.docx 18.8 kB
  • Word/uncle-sam.docx 816.4 kB
  • Word/under-the-bridge-red-hot-chilli-peppers.docx 122.4 kB
  • Word/unit-1-activity-6-dictation-activity.docx 290.0 kB
  • Word/unit-10-movies-copy.docx 19.1 kB
  • Word/unit-10-passive-voice-overview.docx 21.1 kB
  • Word/unit-3.docx 189.0 kB
  • Word/unit-5-_-politics.docx 13.0 kB
  • Word/up-adjectives-and-characters.docx 13.6 kB
  • Word/up2.docx 14.8 kB
  • Word/upperintermediate-test-a-bad-day.docx 18.6 kB
  • Word/use-be-supposed-to-and-speak-out-sentences.docx 143.2 kB
  • Word/used-to-in-class.docx 52.1 kB
  • Word/used-to-vs.docx 223.4 kB
  • Word/used-to.docx 11.4 kB
  • Word/used-to_001.docx 96.5 kB
  • Word/used-to_002.docx 169.7 kB
  • Word/usually-often-etc.docx 13.5 kB
  • Word/vacation-time-ross-and-rachel.docx 219.2 kB
  • Word/valentine-bw.docx 704.5 kB
  • Word/valentine-quotes.docx 16.4 kB
  • Word/valentine180s-colouring.docx 1.8 MB
  • Word/valentines-around-the-world.docx 27.5 kB
  • Word/valentines-day.docx 101.4 kB
  • Word/valentines-day_001.docx 71.1 kB
  • Word/valentines-nicknames.docx 136.3 kB
  • Word/vegetable-vocabulary-test.docx 223.5 kB
  • Word/vegetables-flash-cards.docx 222.6 kB
  • Word/vegetables.docx 307.9 kB
  • Word/vehicles.docx 107.6 kB
  • Word/verb-matching.docx 18.5 kB
  • Word/verb-tenses-2011.docx 69.1 kB
  • Word/verb-tenses-2011_001.docx 93.5 kB
  • Word/verb-tenses-board-game.docx 315.6 kB
  • Word/verb-tenses-board-game_001.docx 367.9 kB
  • Word/verb-tenses-grid.docx 15.9 kB
  • Word/verb-tenses-test.docx 120.5 kB
  • Word/verb-to-be-2.docx 75.0 kB
  • Word/verb-to-be-2_001.docx 75.1 kB
  • Word/verb-to-be-exercises.docx 177.4 kB
  • Word/verb-to-be-for-beginners.docx 314.2 kB
  • Word/verb-to-be-mistakes.docx 18.9 kB
  • Word/verb-to-be-table.docx 14.8 kB
  • Word/verb-to-be.docx 16.7 kB
  • Word/verbs-confused.docx 257.3 kB
  • Word/verbs-i-drink.docx 32.3 kB
  • Word/verbs-with-preposition3.docx 18.2 kB
  • Word/verbs-with-prepositions-2.docx 17.1 kB
  • Word/verbs-with-prepositions.docx 16.8 kB
  • Word/verbs_1_.docx 97.2 kB
  • Word/VERBS_WITH_PREPOSITION3.docx 18.2 kB
  • Word/VERBS_WITH_PREPOSITION3_001.docx 18.2 kB
  • Word/Verbs_with_prepositions_2.docx 17.2 kB
  • Word/Verbs_with_prepositions_2_001.docx 17.1 kB
  • Word/video-disaster_episode.docx 16.2 kB
  • Word/video-episode.docx 17.0 kB
  • Word/video-worksheet.docx 107.4 kB
  • Word/videogtest.docx 419.2 kB
  • Word/vienna-by-billy-joel.docx 23.8 kB
  • Word/views-and-arguments.docx 96.1 kB
  • Word/vincent-van-gogh.docx 14.6 kB
  • Word/vocab-organizer.docx 242.6 kB
  • Word/vocabular-lesson-plan.docx 28.4 kB
  • Word/vocabulary-at-the-restaurant.docx 18.2 kB
  • Word/vocabulary-cards-flyers.docx 22.2 kB
  • Word/vocabulary-for-book-reviews.docx 14.2 kB
  • Word/vocabulary-test-verbs.docx 246.0 kB
  • Word/vocabulary.docx 13.3 kB
  • Word/w.docx 25.3 kB
  • Word/wagi.docx 56.2 kB
  • Word/waiting-for-superman-workshop-copia.docx 1.4 MB
  • Word/wall-e-complete.docx 302.2 kB
  • Word/wallace-gromit-the-wrong-trousers.docx 213.3 kB
  • Word/waltermittycharacteranalysis.docx 25.5 kB
  • Word/wanted-poster.docx 14.0 kB
  • Word/war-of-1812-peace-negotiation-role.docx 233.1 kB
  • Word/warm-up-questions-different-tenses.docx 12.1 kB
  • Word/warwick-avenue-lyrics.docx 90.4 kB
  • Word/was-or-were-when-you-were-mine-song.docx 15.0 kB
  • Word/watch-the-video-and-answer-the-questions.docx 62.7 kB
  • Word/watch-the-video-and-complete-the-sentences.docx 28.4 kB
  • Word/water-cooperation.docx 107.3 kB
  • Word/we-are-sea-animals.docx 292.8 kB
  • Word/we-are-the-champions.docx 12.8 kB
  • Word/we-are-the-world.docx 106.5 kB
  • Word/we-found-love-teens-and-adults.docx 24.5 kB
  • Word/weather-mini.docx 186.9 kB
  • Word/weather-symbols.docx 175.7 kB
  • Word/weather_vocgr-test.docx 63.5 kB
  • Word/websites.docx 299.6 kB
  • Word/wedding-vocab.docx 354.6 kB
  • Word/week.docx 14.3 kB
  • Word/weekdays.docx 22.4 kB
  • Word/weird-transportation.docx 585.3 kB
  • Word/weird-transportation_001.docx 585.2 kB
  • Word/welcome-to-egypt.docx 813.8 kB
  • Word/welcome.docx 365.8 kB
  • Word/wh-game.docx 49.4 kB
  • Word/wh-question-game.docx 11.5 kB
  • Word/wh-question-word-post-office-et-cinema-avanc.docx 33.8 kB
  • Word/wh-question-word-post-office-et-cinema-avanc_001.docx 33.9 kB
  • Word/wh-questions-bord-game.docx 26.4 kB
  • Word/wh-questions-daily-routine.docx 55.7 kB
  • Word/wh-questions.docx 317.5 kB
  • Word/wh.docx 1.9 MB
  • Word/whale-saved-from-fishing-net.docx 375.9 kB
  • Word/what-a-wonderful-world-sung-by-louis-armstrong.docx 3.0 MB
  • Word/what-a-wonderful-world.docx 74.0 kB
  • Word/what-are-you-wearing.docx 67.4 kB
  • Word/what-can-they-do.docx 234.3 kB
  • Word/what-did-you-do-this-week.docx 79.7 kB
  • Word/what-i-eat-during-the-day.docx 146.8 kB
  • Word/what-id-squirrel-thinking.docx 628.9 kB
  • Word/what-if-coldplay.docx 787.3 kB
  • Word/what-is-a-santa-claus-by-stan-kenton.docx 67.9 kB
  • Word/what-is-in-the-fridge.docx 628.8 kB
  • Word/what-is-your-favourite-item-of-clothes.docx 32.4 kB
  • Word/what-makes-you-beautiful-activity.docx 14.2 kB
  • Word/what-s-the-weather-like.docx 593.1 kB
  • Word/what-they-said-what-they-meant.docx 13.6 kB
  • Word/what-time-do-you.docx 124.4 kB
  • Word/what-time-information-gap.docx 18.5 kB
  • Word/what-time-is-it.docx 65.5 kB
  • Word/wheel-of-fortune.docx 83.8 kB
  • Word/when-a-strange-calls.docx 11.7 kB
  • Word/when-is-your-birhday.docx 220.6 kB
  • Word/when-is.docx 11.4 kB
  • Word/when-is_001.docx 14.2 kB
  • Word/where-are-you-from-and-where-in.docx 129.8 kB
  • Word/where-does-halloween-com-from.docx 48.0 kB
  • Word/where-the-wild-roses-grow.docx 13.0 kB
  • Word/whereisclassroom.docx 208.2 kB
  • Word/which-painting-do-you-like.docx 385.5 kB
  • Word/which-room-does-the-furniture-go-in.docx 218.2 kB
  • Word/white-flag.docx 21.2 kB
  • Word/who-am-i-describing.docx 12.7 kB
  • Word/who-am-i-game.docx 19.2 kB
  • Word/who-are-you.docx 162.9 kB
  • Word/who-knew.docx 108.0 kB
  • Word/why-moore-stephens-channel-islands.docx 18.0 kB
  • Word/why-we-have-winter1.docx 219.8 kB
  • Word/why-we-have-winter1_001.docx 219.8 kB
  • Word/why-we-have-winter1_002.docx 219.8 kB
  • Word/will-be-going-to.docx 314.9 kB
  • Word/willgoingtopictures.docx 1.0 MB
  • Word/windsurfing-chose-me-tenses-and-verb-forms.docx 205.4 kB
  • Word/winter-activities.docx 28.9 kB
  • Word/winx-club-season-4-ending-song.docx 551.3 kB
  • Word/wish-exercise-inc.docx 1.2 MB
  • Word/wish-you-were-here-pink-floyd.docx 20.2 kB
  • Word/with-or-without-you-lyrics.docx 443.3 kB
  • Word/wk-3-song-summer-nights-past-tense-verbs.docx 17.5 kB
  • Word/wkst-busyteacher.docx 13.4 kB
  • Word/wolfman-trailer.docx 60.2 kB
  • Word/wonderwall-oasis.docx 38.7 kB
  • Word/woodkid-i-love-you.docx 220.9 kB
  • Word/word-hunt-3.docx 32.4 kB
  • Word/word-order.docx 501.7 kB
  • Word/word-search-entertainment.docx 40.2 kB
  • Word/wordformation.docx 50.9 kB
  • Word/words-with-long-vowel-aa.docx 144.7 kB
  • Word/working-hard.docx 144.7 kB
  • Word/working-with-words.docx 13.0 kB
  • Word/workplace-scenarios-1.docx 15.1 kB
  • Word/worksheeps.docx 51.3 kB
  • Word/worksheet-1.docx 18.0 kB
  • Word/worksheet-6_1b_wordsearch-public-places.docx 140.7 kB
  • Word/worksheet-activit-comparatives.docx 17.3 kB
  • Word/worksheet-colours.docx 37.0 kB
  • Word/worksheet-eight-days-a-week.docx 36.5 kB
  • Word/worksheet-family.docx 363.2 kB
  • Word/worksheet-feelings-and-emotions.docx 1.1 MB
  • Word/worksheet-future.docx 302.1 kB
  • Word/worksheet-how-i-met-your-mother-new-years-eve.docx 63.7 kB
  • Word/worksheet-kirsten-dunst.docx 14.2 kB
  • Word/worksheet-on-adjectives-with-ed-and-ing.docx 13.8 kB
  • Word/worksheet-on-internet-vocabulary.docx 488.7 kB
  • Word/worksheet-project-glass.docx 85.7 kB
  • Word/worksheet-with-quantityadjectives.docx 14.2 kB
  • Word/worksheet-with-quantityadjectives_001.docx 14.2 kB
  • Word/worksheet-with-quantityadjectives_002.docx 19.6 kB
  • Word/worksheet.docx 2.3 MB
  • Word/worksheet_001.docx 132.6 kB
  • Word/worksheet_film_the_descendants.docx 639.1 kB
  • Word/workshop-parts-of-the-house.docx 61.2 kB
  • Word/worst-bed-story-ever.docx 18.1 kB
  • Word/write-a-story-using-words.docx 12.9 kB
  • Word/write-the-horoscope-using-the-future-tense.docx 359.0 kB
  • Word/write-the-past-form-of-the-verbs-in-brackets.docx 77.0 kB
  • Word/write-the-time-in-words.docx 186.6 kB
  • Word/write-what-kate-said.docx 227.4 kB
  • Word/write-your-own-newspaper-article.docx 191.8 kB
  • Word/writing-a-description.docx 14.0 kB
  • Word/writing-a-leaflet.docx 252.0 kB
  • Word/writing-a-paragraph.docx 16.3 kB
  • Word/writing-famous-person.docx 132.1 kB
  • Word/writing-modal-verbs.docx 156.5 kB
  • Word/writing-personal-response-template.docx 16.3 kB
  • Word/writing-worksheet.docx 58.8 kB
  • Word/writing.docx 100.7 kB
  • Word/writing_001.docx 114.7 kB
  • Word/written-test.docx 15.5 kB
  • Word/ws-unit-5.docx 150.1 kB
  • Word/xmasfind.docx 91.9 kB
  • Word/y252klenen-dosya.docx 14.0 kB
  • Word/yellow-spotted-lizards-reading.docx 15.9 kB
  • Word/yes-no-questions-game.docx 301.2 kB
  • Word/yesterday-from-esl-video.docx 14.0 kB
  • Word/yosemite-sam-bugs-bunny-rabbitson-crusoe.docx 212.3 kB
  • Word/you-and-me-lifehouse.docx 14.9 kB
  • Word/you-are-a-newspaper-reporter-from-the-uk.docx 13.9 kB
  • Word/you-are-an-account-manager-in-fortune-bank.docx 40.3 kB
  • Word/you-have-a-friend-in-me-activity-plan-4.docx 114.6 kB
  • Word/you.docx 21.5 kB
  • Word/your-friend-went-to-a-party-last-night-to-be-past.docx 13.1 kB
  • Word/youre-beautiful.docx 236.7 kB
  • Word/youre-beautiful_001.docx 68.5 kB
  • Word/youre-gonna-lose-that-girl.docx 164.2 kB
  • Word/zoo-animals.docx 2.5 MB
  • XLS 97-2003/battleship.xls 18.9 kB
  • XLS 97-2003/bingoduckrabbitbird.xls 99.8 kB
  • XLS 97-2003/chart-present-simple.xls 20.0 kB
  • XLS 97-2003/food-vocabulary1.xls 77.3 kB
  • XLS 97-2003/inversion.xls 21.5 kB
  • XLS 97-2003/irregular-verbs-in-groups_exercise.xls 17.9 kB
  • XLS 97-2003/page-27-adj-bingo.xls 25.1 kB
  • XLS 97-2003/passive.xls 23.6 kB
  • XLS 97-2003/perfil.xls 176.6 kB
  • XLS 97-2003/phonics-chart-a-e-i-o-u.xls 275.5 kB
  • XLS 97-2003/prefixans.xls 9.7 kB
  • XLS 97-2003/present-perfect-x-simple-past.xls 113.2 kB
  • XLS 97-2003/read-match-actions.xls 388.6 kB
  • XLS/crossword.xlsx 13.6 kB
  • XLS/guess-who-boys.xlsx 2.0 MB
  • XLS/guess-who-girls.xlsx 1.3 MB
  • XLS/szitu-pic.xlsx 351.0 kB
  • ZIP/3-worksheets.zip 1.1 MB
  • ZIP/628.zip 98.4 kB
  • ZIP/629.zip 65.7 kB
  • ZIP/63957.zip 321.8 kB
  • ZIP/88-valentines-coloring-pages.zip 6.3 MB
  • ZIP/adjective-clauses.zip 14.3 kB
  • ZIP/bday.zip 43.6 kB
  • ZIP/bookmarks.zip 383.7 kB
  • ZIP/busyteacher-pumpkin-stencils.zip 1.5 MB
  • ZIP/busyteacher-sound-effects.zip 29.4 MB
  • ZIP/ce.zip 102.5 kB
  • ZIP/celebrations.zip 754.7 kB
  • ZIP/chan-bingo.zip 121.2 kB
  • ZIP/chanukah-dreidel.zip 68.4 kB
  • ZIP/chanukah.zip 328.7 kB
  • ZIP/chinese-new-year.zip 1.1 MB
  • ZIP/christmas-activities.zip 672.9 kB
  • ZIP/christmas-connect-the-dots.zip 405.1 kB
  • ZIP/christmas-wordsearches.zip 1.6 MB
  • ZIP/christmas.zip 1.4 MB
  • ZIP/classroom-cards-posters.zip 344.7 kB
  • ZIP/clue-game-print-materials.zip 1.8 MB
  • ZIP/easter.zip 1.2 MB
  • ZIP/emotion-flashcards.zip 168.5 kB
  • ZIP/everyday-decorations.zip 805.0 kB
  • ZIP/fathers-day-flashcards.zip 4.7 MB
  • ZIP/fruit-and-vegetables.zip 203.4 kB
  • ZIP/gunit.zip 31.8 kB
  • ZIP/halloween-classroom-decorations.zip 1.2 MB
  • ZIP/halloween-clipart.zip 1.9 MB
  • ZIP/halloween-coloring-pages.zip 333.4 kB
  • ZIP/halloween-flashcards-busyteacher.zip 9.5 MB
  • ZIP/halloween-stencils2.zip 2.8 MB
  • ZIP/halloween-ws.zip 1.9 MB
  • ZIP/hanukkah-invitation.zip 73.9 kB
  • ZIP/happy-chanukah.zip 74.3 kB
  • ZIP/hoops-yoyo-penelope.zip 486.2 kB
  • ZIP/hoopsyoyo.zip 563.7 kB
  • ZIP/if-you-were-a-song_mark_sholtez.zip 1.9 MB
  • ZIP/joke-pod-casts.zip 4.5 MB
  • ZIP/kelly-clarkson-breakaway-activity-phrasal-verbs.zip 12.9 kB
  • ZIP/kids-thanksgiving-clipart.zip 4.4 MB
  • ZIP/kwanzaa.zip 865.2 kB
  • ZIP/landscapes.zip 3.0 MB
  • ZIP/london-ten-things-you-need-to-know.zip 2.1 MB
  • ZIP/mothers-day-clipart.zip 1.3 MB
  • ZIP/mothers-day.zip 443.6 kB
  • ZIP/new-year.zip 555.6 kB
  • ZIP/oxford-package.zip 652.7 kB
  • ZIP/passive-voice-pictures.zip 3.1 MB
  • ZIP/pencilcase-find-someone.zip 39.9 kB
  • ZIP/quick_fix_5.zip 101.3 kB
  • ZIP/quick_fix_5_001.zip 101.3 kB
  • ZIP/santa-coloring-pages.zip 218.2 kB
  • ZIP/santa-letter.zip 1.1 MB
  • ZIP/seaworld-flashcards.zip 1.0 MB
  • ZIP/song-worksheet-light-between-us.zip 512.9 kB
  • ZIP/split-clothes-cross.zip 163.2 kB
  • ZIP/superlative-presentation.zip 2.1 MB
  • ZIP/valentine-conversation-starter-images.zip 8.4 MB
  • ZIP/valentines-day-bingo.zip 1.3 MB
  • ZIP/valentines-day.zip 450.6 kB
  • ZIP/valentines-day_001.zip 326.3 kB
  • ZIP/wake.zip 15.3 kB
  • ZIP/weekly-planners.zip 365.7 kB
  • ZIP/writing-outline.zip 10.1 kB
  • ZIP/xmas-wrap.zip 953.6 kB

随机展示

相关说明

本站不存储任何资源内容,只收集BT种子元数据(例如文件名和文件大小)和磁力链接(BT种子标识符),并提供查询服务,是一个完全合法的搜索引擎系统。 网站不提供种子下载服务,用户可以通过第三方链接或磁力链接获取到相关的种子资源。本站也不对BT种子真实性及合法性负责,请用户注意甄别!