Cool.Flash.Games -移花宫-武林禁地，闲人禁止入内

Cool.Flash.Games

磁力链接/BT种子名称

Cool.Flash.Games

磁力链接/BT种子简介

种子哈希：f2b43a4fcfa9eea3606473b1140c83916d84837e
文件大小： 14.4G
已经下载：4191次
下载速度：极快
收录时间：2024-08-08
最近下载：2025-12-21

移花宫入口

移花宫.com 邀月.com 怜星.com 花无缺.com yhgbt.icu yhgbt.top

磁力链接下载

magnet:?xt=urn:btih:F2B43A4FCFA9EEA3606473B1140C83916D84837E
推荐使用PIKPAK网盘下载资源，10TB超大空间，不限制资源，无限次数离线下载，视频在线观看

文件列表

Games/Idle Skilling.swf 57.4 MB
Games/super_chibi_knight.swf 51.3 MB
Games/Road of the Dead 2.swf 44.7 MB
Games/soda_dungeon_lite.swf 44.6 MB
Games/lonewolf.swf 41.8 MB
Games/murder_mystery.swf 41.5 MB
Games/League of Legends Cho'Gath Eats the World.swf 40.8 MB
Games/Tooka Laydee.swf 40.4 MB
Games/the_splitting_chapter_2.swf 39.5 MB
Games/Jo99 games/Krystine and the children in chains.swf 37.7 MB
Games/Faradays Flaw.swf 36.6 MB
Games/Back Door Series/back door 3 - the train.swf 36.5 MB
Games/Tequila Zombies 3.swf 36.4 MB
Games/Brave_Heads.swf 36.2 MB
Games/The Henry Stickmen Collection/fleeing_the_complex.swf 34.5 MB
Games/Echoes Operation Stranglehold.swf 34.0 MB
Games/Whack Series/whack_the_serial_killer_escape_from_torture.swf 34.0 MB
Games/Jo99 games/The mother of the bird men.swf 33.6 MB
Games/The Fancy Pants Adventure World Series/The Fancy Pants Adventure World 3.swf 33.2 MB
Games/Jo99 games/The earl octopusor.swf 33.0 MB
Games/Relive Your Life.swf 32.8 MB
Games/arcuz_ii_dungeons.swf 32.4 MB
Games/astrocreep.swf 32.3 MB
Games/kingdom_rush.swf 32.1 MB
Games/Cuboy Series/Cuboy Cubeture 2.swf 31.7 MB
Games/Dead End St..swf 31.4 MB
Games/shark_lifting_2.swf 31.0 MB
Games/Submachine Series/Submachine 10 the Exit.swf 30.5 MB
Games/sierra_7.swf 29.8 MB
Games/The Henry Stickmen Collection/infiltrating_the_airship.swf 29.8 MB
Games/caravaneer_2.swf 29.4 MB
Games/lab_of_the_dead.swf 29.2 MB
Games/Where is series/where_is_2015.swf 29.0 MB
Games/Cube Escape Series/Cube Escape_ The Cave.swf 28.7 MB
Games/Road Of Heroes.swf 27.8 MB
Games/command_control.swf 27.7 MB
Games/decision_3.swf 27.1 MB
Games/lucky_tower_2.swf 27.0 MB
Games/Gunball Reloaded.swf 26.9 MB
Games/road of the dead.swf 25.7 MB
Games/Back Door Series/back_door-_door_2_the_job.swf 24.9 MB
Games/crystal_story_ii.swf 24.8 MB
Games/mr_vengeance_act_3.swf 24.5 MB
Games/knighttron.swf 24.5 MB
Games/wondrous_lands.swf 24.4 MB
Games/the_bravest_hunter.swf 24.2 MB
Games/dungeon_king.swf 24.1 MB
Games/diseviled_2.swf 24.1 MB
Games/Tactical Assassin Mobile.swf 24.0 MB
Games/Bullet Heaven 2.swf 24.0 MB
Games/Stellar Squad.swf 23.8 MB
Games/Nephis Adventure 2.swf 23.7 MB
Games/min_hero_tower_of_sages.swf 22.9 MB
Games/Raze_3.swf 22.8 MB
Games/Raze.swf 22.8 MB
Games/gretel_and_hansel_2.swf 22.8 MB
Games/zombocalypse_2.swf 22.5 MB
Games/Midnight Cinema.swf 22.3 MB
Games/Dinogen.swf 22.1 MB
Games/digiwoog_disaster.swf 21.6 MB
Games/Sonny_2.swf 21.3 MB
Games/cursed_treasure_2.swf 21.2 MB
Games/The Case of the Mysteriously Missing Hat.swf 20.9 MB
Games/sentryknight2.swf 20.9 MB
Games/arm_of_revenge.swf 20.9 MB
Games/Save To Kill.swf 20.8 MB
Games/valthirian_arc_2.swf 20.8 MB
Games/Symon.swf 20.8 MB
Games/stick_squad_4.swf 20.7 MB
Games/Necronator 2.swf 20.7 MB
Games/Dangerous Adventure 2.swf 20.6 MB
Games/Last Legacy Null Space.swf 20.6 MB
Games/mr_vengeance_act_ii.swf 20.5 MB
Games/Armed With Wings Series/armed_with_wings_3.swf 20.5 MB
Games/Madness Series/Madness Project Nexus mod III.swf 20.5 MB
Games/The Last Door Series/The Last Door - Chapter 3 The Four Witnesses.swf 20.5 MB
Games/Battle of Britain 303 Squadron.swf 20.4 MB
Games/paladog.swf 20.4 MB
Games/goblin_treasure_hunt.swf 20.4 MB
Games/Destination Kepler.swf 20.3 MB
Games/xenos.swf 20.2 MB
Games/Lone Survivor Demo.swf 20.1 MB
Games/pewduckpie_2.swf 20.0 MB
Games/mrbreereturninghome.swf 20.0 MB
Games/Santa rockstar series/Santa Rockstar Metal Xmas 3.swf 20.0 MB
Games/The Last Door Series/The Last Door - Chapter 2 Memories.swf 19.9 MB
Games/incursion_2_the_artifact.swf 19.8 MB
Games/AL Project.swf 19.8 MB
Games/The last stand - Union sity.swf 19.8 MB
Games/Jo99 games/The queen of snakes.swf 19.6 MB
Games/Strike Force Heroes 3.swf 19.4 MB
Games/battleforwaylandkeep.swf 19.4 MB
Games/mr_vengeance_upgrade.swf 19.1 MB
Games/intrusion_2.swf 19.1 MB
Games/Nelly 2 ep.1.swf 19.1 MB
Games/deterministic_dungeon.swf 19.1 MB
Games/freakolantern.swf 19.1 MB
Games/specter_knight.swf 19.0 MB
Games/Robert The Elf.swf 19.0 MB
Games/Cardinal Quest 2.swf 19.0 MB
Games/monster_frontier.swf 18.8 MB
Games/mastermind-world-conqueror.swf 18.8 MB
Games/dragon_age_journeys.swf 18.7 MB
Games/The Sagittarian Series/The Sagittarian 4 Berger.swf 18.6 MB
Games/The Gatekeeper.swf 18.6 MB
Games/strikeforceheroes.swf 18.6 MB
Games/asgard_skill_master.swf 18.6 MB
Games/crystalstory.swf 18.5 MB
Games/Convergence.swf 18.5 MB
Games/stick_squad.swf 18.5 MB
Games/Faint.swf 18.5 MB
Games/LARRY and the GNOMES.swf 18.5 MB
Games/youda_mystery_-_stanwick.swf 18.4 MB
Games/Planet Wars.swf 18.4 MB
Games/riddle_transfer_2.swf 18.4 MB
Games/Madness Series/madness_hydraulic.swf 18.3 MB
Games/love_chase.swf 18.3 MB
Games/Choose Your Weapon Series/Choose Your Weapon 5.swf 18.2 MB
Games/sanguine_2.swf 18.0 MB
Games/super_house_of_dead_ninjas.swf 17.9 MB
Games/Madness Series/madness_accelerant.swf 17.9 MB
Games/Jo99 games/humanoid 47.swf 17.9 MB
Games/sushicatapult.swf 17.9 MB
Games/battle_cry_-_ashes_of_berhyte.swf 17.7 MB
Games/daysofblood.swf 17.6 MB
Games/house_of_fear_revenge.swf 17.6 MB
Games/Personal Trip to the Moon.swf 17.5 MB
Games/Morningstar.swf 17.5 MB
Games/Infectonator Series/infectonator_survivors.swf 17.5 MB
Games/The Lonely Square.swf 17.5 MB
Games/forbiddenarms.swf 17.5 MB
Games/learn to fly 3.swf 17.5 MB
Games/a rabbit fable.swf 17.4 MB
Games/mighty_knight.swf 17.4 MB
Games/Kings Ascent.swf 17.4 MB
Games/undeadend2.swf 17.4 MB
Games/Death Arena Reality Show.swf 17.3 MB
Games/fixation.swf 17.1 MB
Games/Santa rockstar series/Santa Rockstar Metal Xmas 4.swf 17.1 MB
Games/shoot-out_in_the_west.swf 17.1 MB
Games/energy_invaders.swf 17.0 MB
Games/Where is series/where_is_2016.swf 17.0 MB
Games/Battle Of Heroes.swf 17.0 MB
Games/freedomtower2.swf 17.0 MB
Games/frozen_islands_new_horizons.swf 17.0 MB
Games/Skullz.swf 16.9 MB
Games/skydefenderjoesstory.swf 16.8 MB
Games/shoctrooper.swf 16.8 MB
Games/deathcall.swf 16.8 MB
Games/castle_woodwarf.swf 16.7 MB
Games/plantera.swf 16.7 MB
Games/nightmare_in_elmore.swf 16.6 MB
Games/Bear in Super Action Adventure 2.swf 16.6 MB
Games/royal_warfare_2.swf 16.6 MB
Games/Mini Dash.swf 16.5 MB
Games/disaster_will_strike_7.swf 16.5 MB
Games/darksoul.swf 16.5 MB
Games/third_kingdom.swf 16.5 MB
Games/takeover.swf 16.5 MB
Games/cellar_door.swf 16.5 MB
Games/steampunktower.swf 16.4 MB
Games/Lethal RPG War Begins.swf 16.4 MB
Games/The Last Door Series/The Last Door - Chapter 1 The Letter.swf 16.4 MB
Games/Detective Grimoire - The Beginning.swf 16.4 MB
Games/strike_force_heroes_2.swf 16.4 MB
Games/Wheely Series/Wheely 7 Detective.swf 16.3 MB
Games/Shark Series/prehistoricshark.swf 16.3 MB
Games/potheadzombies2.swf 16.3 MB
Games/sacred_treasure.swf 16.3 MB
Games/the_last_dinosaurs.swf 16.2 MB
Games/Stick Squad 2.swf 16.2 MB
Games/memohuntress.swf 16.2 MB
Games/Raze_2.swf 16.2 MB
Games/incursion.swf 16.2 MB
Games/Forgotten Hill Series/Forgotten Hill Surgery.swf 16.2 MB
Games/Clear Vision Series/clear_vision_5.swf 16.0 MB
Games/x-ray_detective.swf 16.0 MB
Games/royal_heroes.swf 15.9 MB
Games/bomber_at_war_2_level_pack.swf 15.9 MB
Games/sentryknight.swf 15.9 MB
Games/Rumble in the Soup.swf 15.7 MB
Games/pause ahead.swf 15.7 MB
Games/riddle_transfer.swf 15.6 MB
Games/epic_war_4.swf 15.6 MB
Games/Madness Series/madness-project_nexus.swf 15.6 MB
Games/stick_squad_3.swf 15.5 MB
Games/amea.swf 15.5 MB
Games/relic.swf 15.5 MB
Games/Astro Teemo.swf 15.5 MB
Player/flashplayer_32_sa.exe 15.5 MB
Games/Hero SimulatorIdle Adventures.swf 15.4 MB
Games/armored_warfare_1917.swf 15.4 MB
Games/planet_noevo_ii.swf 15.4 MB
Games/Castle Wars 2.5.swf 15.4 MB
Games/emit.swf 15.4 MB
Games/a_weekend_at_tweety_s.swf 15.4 MB
Games/Bloons Series/Bloons TD 5.swf 15.4 MB
Games/Whack Series/Whack_The_Thief.swf 15.3 MB
Games/Epic Boss Fighter 2.swf 15.3 MB
Games/onceuponalife.swf 15.3 MB
Games/hippolyta.swf 15.2 MB
Games/bomber_at_war_2_battle_for_resources.swf 15.2 MB
Games/The Enchanted Cave 2.swf 15.1 MB
Games/super_adventure_pals.swf 15.1 MB
Games/tavern_of_heroes.swf 15.1 MB
Games/witchhunt.swf 15.0 MB
Games/zombie_crusade.swf 15.0 MB
Games/mad_day_2.swf 14.9 MB
Games/Right hand.swf 14.9 MB
Games/zos.swf 14.9 MB
Games/That red button..swf 14.9 MB
Games/skypanda.swf 14.8 MB
Games/My Little Army.swf 14.8 MB
Games/The Last Door Series/The Last Door - Chapter 4 Ancient Shadows.swf 14.8 MB
Games/abobosbigadventure.swf 14.7 MB
Games/lostoutpost.swf 14.7 MB
Games/Wheely Series/Wheely 5 Armageddon.swf 14.7 MB
Games/furtivedao.swf 14.7 MB
Games/Zombie And Juliet.swf 14.6 MB
Games/The Henry Stickmen Collection/stealing the diamond.swf 14.6 MB
Games/Riddle School Series/riddle_school_5.swf 14.5 MB
Games/dead paradise 3.swf 14.5 MB
Games/creeping.swf 14.5 MB
Games/attack_of_the_johnnies.swf 14.5 MB
Games/richcars3hustle.swf 14.4 MB
Games/arcuz_behind_the_dark.swf 14.3 MB
Games/Super Crazy Guitar Maniac Deluxe Series/super_crazy_guitar_maniac_deluxe_4.swf 14.2 MB
Games/netherrunner.swf 14.2 MB
Games/Revenge of The Kid.swf 14.2 MB
Games/Tainted Olive - Chapter 2.swf 14.2 MB
Games/warlordsepicconflict.swf 14.2 MB
Games/battlecry.swf 14.1 MB
Games/You're Grounded!.swf 14.1 MB
Games/Ecotone.swf 14.1 MB
Games/royal_warfare.swf 14.0 MB
Games/Loot Heroes Clicker.swf 13.9 MB
Games/tribot fighter.swf 13.9 MB
Games/Trafalgar Origins.swf 13.9 MB
Games/Forgotten Hill Series/Forgotten Hill puppeteer.swf 13.8 MB
Games/epic_battle_fantasy_2.swf 13.8 MB
Games/the_utans_-_defender_of_mavas.swf 13.8 MB
Games/intruder_combat_training_2x.swf 13.8 MB
Games/epic_time_pirates.swf 13.8 MB
Games/Daymare Series/Daymare Town 4.swf 13.8 MB
Games/vi_defenders.swf 13.7 MB
Games/Wheely Series/Wheely 4 Time Travel.swf 13.7 MB
Games/Ching Chong Beautiful.swf 13.7 MB
Games/Monster Detective.swf 13.6 MB
Games/legionofredwolves.swf 13.6 MB
Games/Robots Continue Work Sequence.swf 13.6 MB
Games/call_of_sword.swf 13.6 MB
Games/immortal_souls_dark_crusade.swf 13.6 MB
Games/rearmed_trials.swf 13.6 MB
Games/Pragaras.swf 13.5 MB
Games/gentlegravity.swf 13.5 MB
Games/frantic 3.swf 13.5 MB
Games/reverie.swf 13.5 MB
Games/Earth Taken 3.swf 13.5 MB
Games/royalsquad.swf 13.5 MB
Games/Tequila_Zombies_2.swf 13.4 MB
Games/Urbex.swf 13.4 MB
Games/diseviled.swf 13.4 MB
Games/1 screen hero.swf 13.4 MB
Games/Nayas Quest.swf 13.3 MB
Games/war_zomb_avatar.swf 13.2 MB
Games/legend_of_johnny.swf 13.2 MB
Games/caribbean_admiral_2.swf 13.2 MB
Games/arcalona.swf 13.2 MB
Games/Royal Protectors.swf 13.2 MB
Games/Decision 2.swf 13.2 MB
Games/Vortex Point Series/Vortex Point 7.swf 13.2 MB
Games/Dangerous adventure.swf 13.2 MB
Games/Tip of the Tongue.swf 13.2 MB
Games/Cyber Chaser Counterthrust.swf 13.1 MB
Games/freeway fury 3.swf 13.1 MB
Games/Deep Sleep Series/The Deepest Sleep.swf 13.1 MB
Games/dirt_showdown.swf 13.1 MB
Games/ZS Dead Detective Series/Zombie Society - Death after death 13.swf 13.1 MB
Games/house_of_wolves.swf 13.1 MB
Games/utopianmining.swf 13.1 MB
Games/carrot_fantasy_extreme.swf 13.0 MB
Games/vilesteel.swf 13.0 MB
Games/Rawr.swf 13.0 MB
Games/epic_war_3.swf 13.0 MB
Games/westerado.swf 12.9 MB
Games/The Several Journeys of Reemus Chapter 1.swf 12.9 MB
Games/Cuboy Series/backtothecubeture1.swf 12.9 MB
Games/Thing-Thing Series/thing-thing_arena_classic.swf 12.9 MB
Games/Nano Kingdoms.swf 12.9 MB
Games/Smells Like Art.swf 12.9 MB
Games/civilization_wars_4_monsters.swf 12.9 MB
Games/Dark Cut 3.swf 12.8 MB
Games/Run3.swf 12.8 MB
Games/hordesandlords.swf 12.8 MB
Games/3 Pandas Series/3 Pandas in Brazil.swf 12.8 MB
Games/Kingdom of Liars 3.swf 12.8 MB
Games/The Cave of Ātman.swf 12.8 MB
Games/Band Of Heroes.swf 12.8 MB
Games/enolaprelude.swf 12.7 MB
Games/Nick Toldy and the Legend of Dragon Peninsula.swf 12.7 MB
Games/Back Door Series/back_door-_door_1_the_call.swf 12.6 MB
Games/missioninspacethelostcolony.swf 12.6 MB
Games/The Fabulous Screech.swf 12.6 MB
Games/berzerk_ball_2.swf 12.5 MB
Games/Into_Space_2.swf 12.5 MB
Games/dead paradise 2.swf 12.5 MB
Games/maplewood_junior_high.swf 12.5 MB
Games/Doppelgänger.swf 12.5 MB
Games/BLACK IV.swf 12.5 MB
Games/monsterstd2.swf 12.5 MB
Games/monstersaga.swf 12.5 MB
Games/Robokill 2-Leviatan Five.swf 12.4 MB
Games/Legend of the Void.swf 12.4 MB
Games/bloomo_a_submarine_adventure.swf 12.4 MB
Games/Thing-Thing Series/thing-thing_arena_pro.swf 12.4 MB
Games/Deep Sleep Series/deeper sleep.swf 12.4 MB
Games/Smash_Palace.swf 12.4 MB
Games/farm-express.swf 12.4 MB
Games/chaos_faction_2.swf 12.3 MB
Games/Ray Ardent Science Ninja.swf 12.3 MB
Games/idlers_and_dungeons.swf 12.3 MB
Games/Skip Around the World - India.swf 12.3 MB
Games/3 Pandas Series/3 Pandas in Fantasy.swf 12.3 MB
Games/Zombotron 2 Time Machine.swf 12.2 MB
Games/asgard_story.swf 12.2 MB
Games/super_castle_sprint.swf 12.2 MB
Games/dynasty_war.swf 12.2 MB
Games/mr_vengeance_act-i.swf 12.2 MB
Games/Crazy Christmas.swf 12.2 MB
Games/empiresofarkeia.swf 12.2 MB
Games/Snail Bob Series/snail_bob_8 Island Story.swf 12.1 MB
Games/Covert Front Series/covert_front_4.swf 12.1 MB
Games/Zombotron 2.swf 12.1 MB
Games/gentlemens_club.swf 12.1 MB
Games/Shark Series/newyorkshark.swf 12.1 MB
Games/mega_mechs_2.swf 12.0 MB
Games/Tammy Jo Superstar.swf 12.0 MB
Games/Vortex Point Series/Vortex Point 5 - Monster Movie.swf 12.0 MB
Games/band_of_heroes_might_and_pillage.swf 12.0 MB
Games/Home Sheep Home Series/Home_Sheep_Home_2_Lost_In_London.swf 12.0 MB
Games/storm_ops_3.swf 12.0 MB
Games/Forgotten Hill Series/Forgotten Hill. Memento Playground.swf 12.0 MB
Games/Home Sheep Home Series/home_sheep_home_2_lost_in_space.swf 11.9 MB
Games/Amigo Pancho Series/Amigo Pancho 5_ Arctic and Peru.swf 11.9 MB
Games/blueprint3d.swf 11.9 MB
Games/Quietus.swf 11.9 MB
Games/A House in California.swf 11.9 MB
Games/Ode To Pixel Days.swf 11.8 MB
Games/Home Sheep Home Series/home_sheep_home_2_lost_underground.swf 11.8 MB
Games/Sift Heads Series/sift_heads_cartels_-_act_3.swf 11.8 MB
Games/Ubooly Friends.swf 11.8 MB
Games/The Story of Brewster Chipptooth.swf 11.8 MB
Games/Wheely Series/Wheely 6 Fairytale.swf 11.7 MB
Games/speedrunner.swf 11.7 MB
Games/demonsvsfairyland.swf 11.7 MB
Games/Skip Around the World Finland Suomi.swf 11.7 MB
Games/monster_craft_2.swf 11.7 MB
Games/Dfragmente.swf 11.7 MB
Games/Drunken Assasin.swf 11.7 MB
Games/hero_of_inferno.swf 11.7 MB
Games/dead paradise.swf 11.6 MB
Games/Disaster Will Strike 5.swf 11.6 MB
Games/dead_zed_2.swf 11.6 MB
Games/Bro_vs_Zombie.swf 11.6 MB
Games/give_up_2.swf 11.5 MB
Games/Ossuary The Hodge-Podge Transformer.swf 11.5 MB
Games/No Time to Explain Remastered Demo.swf 11.5 MB
Games/g-switch-3.swf 11.5 MB
Games/Tower of Heaven.swf 11.4 MB
Games/escapefrompuppydeathfactory.swf 11.4 MB
Games/PewDuckPie.swf 11.4 MB
Games/Dont Escape 3.swf 11.3 MB
Games/Monster Love.swf 11.3 MB
Games/night_at_the_colosseum.swf 11.3 MB
Games/Zombie_World_Game.swf 11.3 MB
Games/doom_triple_pack.swf 11.2 MB
Games/keeperofthegrove.swf 11.2 MB
Games/StrikeForce Kitty Series/strikeforce_kitty_2.swf 11.2 MB
Games/nomnation.swf 11.2 MB
Games/skyquest.swf 11.1 MB
Games/Decision.swf 11.1 MB
Games/Super Mario 63.swf 11.1 MB
Games/Ms Vision by Proxy.swf 11.1 MB
Games/Vortex Point Series/Vortex Point 6.swf 11.1 MB
Games/piggywiggy3.swf 11.0 MB
Games/Hidden Valley Ninja.swf 11.0 MB
Games/army_of_ages.swf 11.0 MB
Games/crush_the_castle_2.swf 11.0 MB
Games/frozenislands.swf 10.9 MB
Games/stealth_bound_level_pack.swf 10.9 MB
Games/cyberchaser.swf 10.9 MB
Games/coldgrip.swf 10.9 MB
Games/Monster Squad.swf 10.9 MB
Games/The Fog Fall 3.swf 10.9 MB
Games/disasterwillstrike3.swf 10.9 MB
Games/sentry_knight_conquest.swf 10.9 MB
Games/ravencrime.swf 10.8 MB
Games/mineit.swf 10.8 MB
Games/Clear Vision Series/clear_vision_4.swf 10.8 MB
Games/the_splitting.swf 10.8 MB
Games/pocket creatures pvp.swf 10.8 MB
Games/Car Eats Car 3.swf 10.8 MB
Games/install_d.swf 10.7 MB
Games/cardboardboxassembler.swf 10.7 MB
Games/quantum_patrol.swf 10.7 MB
Games/Dont Escape 2.swf 10.7 MB
Games/stormy_castle.swf 10.7 MB
Games/sandsofthecoliseum.swf 10.7 MB
Games/Headless Zombie.swf 10.7 MB
Games/rupertszombiediary.swf 10.7 MB
Games/shapeshifter2.swf 10.6 MB
Games/kickthecritter.swf 10.6 MB
Games/zombiedemolisher.swf 10.6 MB
Games/questopia.swf 10.6 MB
Games/dino_run_enter_planet_d.swf 10.5 MB
Games/zombies in the shadow the saviour act 2.swf 10.5 MB
Games/the_keeper_of_4_elements.swf 10.5 MB
Games/pandauprising.swf 10.5 MB
Games/RAID Mission.swf 10.5 MB
Games/sequester.swf 10.5 MB
Games/parasite strike.swf 10.5 MB
Games/battlepanic.swf 10.5 MB
Games/Eisydian Saga.swf 10.5 MB
Games/Record Tripping.swf 10.5 MB
Games/hetherdale.swf 10.5 MB
Games/gare.swf 10.4 MB
Games/Payphone Mania!.swf 10.4 MB
Games/crush the castle 2 players pack.swf 10.4 MB
Games/damn birds 2.swf 10.4 MB
Games/Project Wasteland 0.swf 10.4 MB
Games/mogo_mogo.swf 10.4 MB
Games/bombrunner.swf 10.4 MB
Games/earth_taken_2.swf 10.4 MB
Games/cactusmccoy2.swf 10.4 MB
Games/Santa rockstar series/Santa Rockstar Metal Xmas 2.swf 10.4 MB
Games/Dragon Boy 2.swf 10.4 MB
Games/Where is series/where_is_2013.swf 10.4 MB
Games/billy_makin_kid.swf 10.4 MB
Games/dragon_fortress.swf 10.4 MB
Games/Symbiosis Greenland.swf 10.4 MB
Games/Tales of Carmelot - The Missing Pot of Gold.swf 10.3 MB
Games/ski_safari.swf 10.3 MB
Games/Excavate!.swf 10.3 MB
Games/royaloffense.swf 10.3 MB
Games/Vorago.swf 10.3 MB
Games/The Grey Rainbow.swf 10.3 MB
Games/Days 2 Die - The Other Side.swf 10.3 MB
Games/Zombinsanity.swf 10.3 MB
Games/gretel and hansel.swf 10.3 MB
Games/Building Rush 2.swf 10.2 MB
Games/muu just another day.swf 10.2 MB
Games/Paladin The Game.swf 10.2 MB
Games/xenosquad.swf 10.2 MB
Games/paladin.swf 10.2 MB
Games/Piece of Princess Cake.swf 10.2 MB
Games/failman.swf 10.2 MB
Games/mr_splibox_2.swf 10.2 MB
Games/armor mayhem.swf 10.2 MB
Games/pheusandmor.swf 10.2 MB
Games/Amigo Pancho Series/Amigo Pancho 3 Sheriff Sancho.swf 10.2 MB
Games/Wilt Last Blossom.swf 10.2 MB
Games/glean.swf 10.2 MB
Games/shadowless.swf 10.1 MB
Games/3 Pandas Series/3 Pandas in Japan.swf 10.1 MB
Games/red_ball_3.swf 10.1 MB
Games/2112_cooperation_series/2112_cooperation_chapter_5.swf 10.1 MB
Games/Alice is dead 3.swf 10.1 MB
Games/Freeway Fury 2.swf 10.1 MB
Games/Crunchdown.swf 10.0 MB
Games/seed of destruction.swf 10.0 MB
Games/art_of_war_omaha.swf 10.0 MB
Games/pirateers.swf 10.0 MB
Games/ray_and_cooper_2.swf 10.0 MB
Games/elite_squad.swf 10.0 MB
Games/skinny.swf 9.9 MB
Games/Knightfall 2.swf 9.9 MB
Games/Snail Bob Series/snail_bob_6_winter_story.swf 9.9 MB
Games/gravity_guy.swf 9.9 MB
Games/pirates of the undead sea.swf 9.9 MB
Games/Shark Series/los_angeles_shark.swf 9.9 MB
Games/loondon.swf 9.9 MB
Games/Zombies in the shadow act 1.swf 9.9 MB
Games/robinsoncrusoe.swf 9.9 MB
Games/slush invaders game.swf 9.9 MB
Games/the_pretender_part_three.swf 9.8 MB
Games/Morbid Chapter 2.swf 9.8 MB
Games/13daysafter.swf 9.8 MB
Games/Alien Anarchy.swf 9.8 MB
Games/stealth_bound.swf 9.8 MB
Games/Monsters Den Chronicles.swf 9.8 MB
Games/The Impossible Quiz 2.swf 9.8 MB
Games/dungeon runner.swf 9.8 MB
Games/vampire skills.swf 9.8 MB
Games/dawn_of_the_sniper_2.swf 9.8 MB
Games/DarkBase 3 - Phoenix Team.swf 9.8 MB
Games/Sonny.swf 9.8 MB
Games/polar tale.swf 9.8 MB
Games/The Fancy Pants Adventure World Series/The Fancy Pants Adventure World 2.swf 9.8 MB
Games/spy car.swf 9.8 MB
Games/pestilence z.swf 9.8 MB
Games/killer_escape.swf 9.8 MB
Games/The Henry Stickmen Collection/escaping_the_prison.swf 9.7 MB
Games/endeavor.swf 9.7 MB
Games/Forgotten Hill Series/forgotten hill fall.swf 9.7 MB
Games/reaching_finality.swf 9.7 MB
Games/Wheely Series/Wheely 3.swf 9.7 MB
Games/Sift Heads Series/sift_heads_street_wars_prologue.swf 9.7 MB
Games/Clear Vision Series/clear_vision_elite.swf 9.7 MB
Games/Snail Bob Series/snail_bob_5 love story.swf 9.7 MB
Games/rizk.swf 9.7 MB
Games/buildup.swf 9.7 MB
Games/tony robinson`s weird world of wonders.swf 9.7 MB
Games/darkbase-2-4033.swf 9.7 MB
Games/dark_base_ii_-_the_hive.swf 9.7 MB
Games/nuclear gun.swf 9.7 MB
Games/sketch_quest.swf 9.7 MB
Games/lucky tower.swf 9.7 MB
Games/mike-shadow-i-paid-for-it.swf 9.7 MB
Games/little_wheel.swf 9.7 MB
Games/draw and fly.swf 9.7 MB
Games/Super Crazy Guitar Maniac Deluxe Series/super_crazy_guitar_maniac_deluxe_3.swf 9.6 MB
Games/Kingdom of Liars 2.swf 9.6 MB
Games/transmorpher2.swf 9.6 MB
Games/Submachine Series/Submachine 9 the Temple.swf 9.6 MB
Games/The Sagittarian Series/the sagittarian 2.swf 9.6 MB
Games/Clear Vision Series/clear_vision_2.swf 9.6 MB
Games/The Guardian Chapter 2 Lantern Of Nightmares.swf 9.6 MB
Games/Daymare Series/Daymare Town 3.swf 9.6 MB
Games/gunball_2_-_emperors_revenge.swf 9.6 MB
Games/mr_splibox_the_christmas_story.swf 9.6 MB
Games/Guitar Geek.swf 9.6 MB
Games/super_battle_city.swf 9.6 MB
Games/Siege Hero Pirate Pillage.swf 9.6 MB
Games/WW2 dogfight age of Warplane.swf 9.6 MB
Games/zombiecats.swf 9.6 MB
Games/Vortex Point Series/VortexPoint4.swf 9.6 MB
Games/loot_hero.swf 9.6 MB
Games/Armed With Wings Series/armed_with_wings_2.swf 9.5 MB
Games/timekiller.swf 9.5 MB
Games/Look_out_Mr_Johnson.swf 9.5 MB
Games/littlewars.swf 9.5 MB
Games/The Body.swf 9.5 MB
Games/zombiesintheshadow.swf 9.5 MB
Games/BNKR.swf 9.5 MB
Games/Cool Story Bro.swf 9.5 MB
Games/rogue_soul_2.swf 9.5 MB
Games/Newtons Law.swf 9.4 MB
Games/A Kitty Dream.swf 9.4 MB
Games/Covert Front Series/Covert Front 3 Night in Zurich.swf 9.4 MB
Games/the scene of the crime golden doll.swf 9.4 MB
Games/deepandblue.swf 9.4 MB
Games/Santa rockstar series/Santa Rockstar Metal Xmas.swf 9.4 MB
Games/overhaul.swf 9.4 MB
Games/Sichiken.swf 9.4 MB
Games/i_saw_her_across_the_world.swf 9.4 MB
Games/Marrakesh Club.swf 9.3 MB
Games/Robo Trobo.swf 9.3 MB
Games/pillow_city.swf 9.3 MB
Games/more_zombies.swf 9.3 MB
Games/zombieoutbreak2.swf 9.3 MB
Games/zombudoy_3_pirates.swf 9.3 MB
Games/running_fred_lite.swf 9.3 MB
Games/Cube Escape Series/Cube Escape_ Birthday.swf 9.3 MB
Games/Killer Escape 2.swf 9.3 MB
Games/the_prince_edward.swf 9.3 MB
Games/catchaduck.swf 9.3 MB
Games/game_over_gopher.swf 9.3 MB
Games/relic_of_war.swf 9.2 MB
Games/NONDEVICER.swf 9.2 MB
Games/solclockworkpart1.swf 9.2 MB
Games/Arsenal 2 Romanov Files.swf 9.2 MB
Games/Red Ball 4 (vol.1).swf 9.2 MB
Games/The Several Journeys of Reemus Chapter 3.swf 9.2 MB
Games/bobtherobber.swf 9.2 MB
Games/hanna in a choppa 2.swf 9.2 MB
Games/Paper Venture.swf 9.2 MB
Games/Anaksha Female Assassin.swf 9.2 MB
Games/bela_kovacs_and_the_trail_of_blood.swf 9.2 MB
Games/Amigo Pancho Series/Amigo Pancho 6.swf 9.2 MB
Games/Headless Zombie 2.swf 9.1 MB
Games/baronsgate2.swf 9.1 MB
Games/Shark Series/medieval shark.swf 9.1 MB
Games/planetjuicer.swf 9.1 MB
Games/bobtherobber2.swf 9.1 MB
Games/earth_taken.swf 9.1 MB
Games/the_breach.swf 9.1 MB
Games/william_and_sly_2.swf 9.1 MB
Games/zombotron.swf 9.1 MB
Games/siegius_arena.swf 9.1 MB
Games/Jo99 games/ilemysterieuse49.swf 9.1 MB
Games/dungeon_clicker.swf 9.1 MB
Games/bazookipocalypse.swf 9.1 MB
Games/let_s_journey_2.swf 9.0 MB
Games/magnetizr.swf 9.0 MB
Games/quake_flash.swf 9.0 MB
Games/qcompressingtheheart.swf 9.0 MB
Games/Armed With Wings Series/armed_with_wings_-_culmination.swf 9.0 MB
Games/ninjaland.swf 9.0 MB
Games/electricboy.swf 9.0 MB
Games/Shark Series/sydneyshark.swf 9.0 MB
Games/mandrake.swf 9.0 MB
Games/Sherlock Holmes 2.swf 9.0 MB
Games/Adam and Eve.swf 8.9 MB
Games/star_cars.swf 8.9 MB
Games/Fire_Catcher.swf 8.9 MB
Games/3 Pandas Series/3 Pandas 2. Night.swf 8.9 MB
Games/Amigo Pancho Series/Amigo Pancho 4.swf 8.9 MB
Games/neil_the_nail.swf 8.9 MB
Games/Zombus.swf 8.9 MB
Games/Gun Mayhem 2More Mayhem.swf 8.9 MB
Games/The Book of Living Magic.swf 8.9 MB
Games/nightlights.swf 8.9 MB
Games/Portal Defenders.swf 8.9 MB
Games/Catastrophe Escape.swf 8.9 MB
Games/mechanicalcommando2.swf 8.9 MB
Games/bobbys_not_so_average_adventure.swf 8.9 MB
Games/huebrix.swf 8.9 MB
Games/johnny_rocketfingers_2.swf 8.9 MB
Games/disasterwillstrike 4. ultimatedisaster.swf 8.8 MB
Games/madburger3.swf 8.8 MB
Games/tinyking.swf 8.8 MB
Games/Sift Heads Series/sift_heads_1_remasterized.swf 8.8 MB
Games/Owl's Nest.swf 8.8 MB
Games/SUPER SMASH FLASH.swf 8.8 MB
Games/The Last Stand 2.swf 8.8 MB
Games/Trapped.swf 8.8 MB
Games/coma.swf 8.8 MB
Games/rich-cars.swf 8.8 MB
Games/skullface.swf 8.8 MB
Games/dead_zed.swf 8.8 MB
Games/max_fury.swf 8.8 MB
Games/quantumzombies.swf 8.8 MB
Games/zombobusterrising.swf 8.8 MB
Games/bloom_defender.swf 8.8 MB
Games/cursed_treasure_lp.swf 8.8 MB
Games/burrito bison revenge.swf 8.7 MB
Games/Persist.swf 8.7 MB
Games/Midnight Spooks.swf 8.7 MB
Games/Whack Series/whack_the_terrorist.swf 8.7 MB
Games/liquid2.swf 8.7 MB
Games/warfare_1944.swf 8.7 MB
Games/Toxers.swf 8.7 MB
Games/Swords and Souls.swf 8.7 MB
Games/Snail Bob Series/snail_bob_7_fantasy_story.swf 8.7 MB
Games/purpleplanet.swf 8.6 MB
Games/Feed Us Series/feed_us_5.swf 8.6 MB
Games/zombobuster.swf 8.6 MB
Games/humaliensbattle2.swf 8.6 MB
Games/2112_cooperation_series/2112_cooperation_chapter_1.swf 8.6 MB
Games/kings_guard.swf 8.6 MB
Games/Sift Heads Series/sift_heads_ultimatum.swf 8.6 MB
Games/the_visit.swf 8.6 MB
Games/Killer Escape 3.swf 8.6 MB
Games/jellygo.swf 8.6 MB
Games/Wheely Series/Wheely 2.swf 8.6 MB
Games/MadBurger_2.swf 8.6 MB
Games/Bazooka Boy Series/Bazooka Boy 3.swf 8.6 MB
Games/siegeknight.swf 8.6 MB
Games/burrito bison.swf 8.5 MB
Games/clicker_troops.swf 8.5 MB
Games/days_of_monsters.swf 8.5 MB
Games/disaster_will_strike_6.swf 8.5 MB
Games/Upgrade Complete 2.swf 8.5 MB
Games/2112_cooperation_series/2112_cooperation_chapter_3.swf 8.5 MB
Games/holdthefort.swf 8.5 MB
Games/richmine2xmaspack.swf 8.5 MB
Games/Sacred Heroes.swf 8.5 MB
Games/flight.swf 8.5 MB
Games/The Several Journeys of Reemus Chapter 4.swf 8.4 MB
Games/howmonica.swf 8.4 MB
Games/faster_than_zombies.swf 8.4 MB
Games/zombudoy.swf 8.4 MB
Games/fishy_waters.swf 8.4 MB
Games/Cardinal Quest.swf 8.4 MB
Games/stupidella.swf 8.4 MB
Games/ragdollachievement2.swf 8.4 MB
Games/madville.swf 8.3 MB
Games/Armed With Wings Series/armed-with-wings.swf 8.3 MB
Games/boompirates.swf 8.3 MB
Games/jellyescape.swf 8.3 MB
Games/mylifeisyours.swf 8.3 MB
Games/Red Code 2.swf 8.3 MB
Games/long_way.swf 8.3 MB
Games/Aqua Boy.swf 8.3 MB
Games/grab_that_grub.swf 8.3 MB
Games/rich-cars-2-adrenaline-rush.swf 8.3 MB
Games/Cinema Madness.swf 8.3 MB
Games/Bad Viking and the Curse of the Mushroom King.swf 8.3 MB
Games/Iron Knight.swf 8.3 MB
Games/Capn Marcela Parrot Charmer.swf 8.3 MB
Games/caribbeanadmiral.swf 8.3 MB
Games/nightflies2.swf 8.3 MB
Games/the_royal_archers.swf 8.3 MB
Games/Midnight Spooks 2.swf 8.2 MB
Games/stealth_hunter_2.swf 8.2 MB
Games/Sushi Cat Series/sushicat2thegreatpurrade.swf 8.2 MB
Games/offspringfling.swf 8.2 MB
Games/elfstory.swf 8.2 MB
Games/the_bank_robber.swf 8.2 MB
Games/The Last Door Series/The Last Door Prologue.swf 8.2 MB
Games/roadz.swf 8.2 MB
Games/mage_runner.swf 8.2 MB
Games/whereismybeard.swf 8.2 MB
Games/tinysasters2.swf 8.2 MB
Games/Cube Escape Series/Cube Escape_ Theatre.swf 8.1 MB
Games/Battle Sails.swf 8.1 MB
Games/aboveaverageguy.swf 8.1 MB
Games/humaliens-battle.swf 8.1 MB
Games/thegolem.swf 8.1 MB
Games/Hobo Series/hobo_5_space_brawl.swf 8.1 MB
Games/Sift Heads Series/sift_heads_world_act_5.swf 8.1 MB
Games/gunshotcowboy.swf 8.1 MB
Games/Sift Heads Series/sift_heads_cartels_-_act_1.swf 8.1 MB
Games/Amigo Pancho Series/Amigo Pancho Death Star.swf 8.1 MB
Games/Whack Series/dont_whack_your_teacher.swf 8.1 MB
Games/Bear in Super Action Adventure.swf 8.1 MB
Games/pourthefish.swf 8.1 MB
Games/baron_s_door.swf 8.0 MB
Games/Reincarnation Series/Reincarnation The Final Happy Hour.swf 8.0 MB
Games/Loot Heroes 2.swf 8.0 MB
Games/loot_heroes_ii.swf 8.0 MB
Games/sandsofdoom.swf 8.0 MB
Games/lineoffire.swf 8.0 MB
Games/pixelescape.swf 8.0 MB
Games/g-switch-2.swf 8.0 MB
Games/Pandesal Boy.swf 8.0 MB
Games/Pour The Fish Level Pack.swf 8.0 MB
Games/Hobo Series/hobo_vs_zombies.swf 8.0 MB
Games/deathlab.swf 8.0 MB
Games/Cursed Treasure Dont Touch My Gems!.swf 8.0 MB
Games/boisdarc.swf 8.0 MB
Games/king_s_rush.swf 8.0 MB
Games/The Fog Fall 4.swf 8.0 MB
Games/3lindgame.swf 8.0 MB
Games/Tainted Olive - Chapter 1.swf 7.9 MB
Games/planet_noevo.swf 7.9 MB
Games/Danger Dungeon.swf 7.9 MB
Games/lee_lee_s_quest_2.swf 7.9 MB
Games/murder.swf 7.9 MB
Games/zombietank.swf 7.9 MB
Games/The Several Journeys of Reemus Chapter 2.swf 7.9 MB
Games/discount mayonnaise.swf 7.9 MB
Games/dragon age legends remix01.swf 7.9 MB
Games/Amigo Pancho Series/Amigo Pancho 7.swf 7.9 MB
Games/swarm_queen.swf 7.9 MB
Games/zombiesintheshadow20todie.swf 7.9 MB
Games/siege hero viking vengeance.swf 7.9 MB
Games/Sift Heads Series/Sift Heads World Act 7 - Ultimatum.swf 7.9 MB
Games/castle_rush.swf 7.9 MB
Games/Bite jacker.swf 7.9 MB
Games/Forgotten Hill Series/Forgotten Hill. Memento buried things.swf 7.9 MB
Games/Kingdom of Liars 1.swf 7.9 MB
Games/Dakota Winchesters Adventures - Part 2 Cactus City.swf 7.8 MB
Games/project alnilam.swf 7.8 MB
Games/Riddle School Series/riddle_school-3.swf 7.8 MB
Games/seedling.swf 7.8 MB
Games/transylvania.swf 7.8 MB
Games/monstercraft.swf 7.8 MB
Games/The Sagittarian Series/The Sagittarian 3.swf 7.8 MB
Games/Toss_the_turtle.swf 7.8 MB
Games/state_of_zombies_3.swf 7.8 MB
Games/Snail Bob Series/snail_bob_3.swf 7.8 MB
Games/dawn_of_the_sniper.swf 7.8 MB
Games/Sift Heads Series/sift_heads_world_act_4.swf 7.8 MB
Games/Feed Us Series/feed_us_-_pirates.swf 7.8 MB
Games/Achilles II Origin of a Legend.swf 7.7 MB
Games/babylon.swf 7.7 MB
Games/gingerbreadcircus3.swf 7.7 MB
Games/Sieger Series/sieger_rebuilt_to_destroy.swf 7.7 MB
Games/good daddy_2.swf 7.7 MB
Games/mafiastories.swf 7.7 MB
Games/Frog Fable.swf 7.7 MB
Games/ZS Dead Detective Series/ZS Dead Detective - A cat's chance in hell.swf 7.7 MB
Games/warlords-2-rise-of-demons.swf 7.7 MB
Games/Paul & Percy.swf 7.7 MB
Games/avengers_global_chaos.swf 7.7 MB
Games/adventuresofvalentin.swf 7.7 MB
Games/3 Pandas Series/3 Pandas.swf 7.7 MB
Games/cyclomaniacsepic.swf 7.6 MB
Games/cursedtreasurelevelpack.swf 7.6 MB
Games/Shift Series/shift freedom.swf 7.6 MB
Games/lakeview_cabin.swf 7.6 MB
Games/the_evening_of_the_son.swf 7.6 MB
Games/The Sun for The Vampire.swf 7.6 MB
Games/Upgrade Complete 3.swf 7.6 MB
Games/baberescue.swf 7.6 MB
Games/rew2.swf 7.5 MB
Games/Vision by Proxy 2nd Ed..swf 7.5 MB
Games/Sieger Series/sieger_-_level_pack.swf 7.5 MB
Games/vex3.swf 7.5 MB
Games/zombiesatemyphone.swf 7.5 MB
Games/Closure.swf 7.5 MB
Games/cyclomaniacs2.swf 7.5 MB
Games/Evilgeddon Spooky Max.swf 7.5 MB
Games/run2livegreatescape.swf 7.5 MB
Games/fractured2.swf 7.5 MB
Games/madeinmafia.swf 7.5 MB
Games/blackwoodprologue.swf 7.5 MB
Games/Kram Keep.swf 7.5 MB
Games/belialchapter2.swf 7.5 MB
Games/Cube Escape Series/Cube Escape_ Seasons.swf 7.5 MB
Games/L.I.F.E..swf 7.5 MB
Games/Back to Zombieland.swf 7.5 MB
Games/Jo and Momo Forest Rush.swf 7.4 MB
Games/Stick of Death.swf 7.4 MB
Games/aurora2.swf 7.4 MB
Games/Earn To Die Series/earn_to_die-2_exodus.swf 7.4 MB
Games/awesome_run_2.swf 7.4 MB
Games/Wheely Series/Wheely 8 Aliens.swf 7.4 MB
Games/battle_stance_human_campaign.swf 7.4 MB
Games/awesome_happy_monster.swf 7.4 MB
Games/teslawarofcurrents.swf 7.4 MB
Games/ZS Dead Detective Series/ZS Dead Detective - Rats in a hole.swf 7.4 MB
Games/awesome_tanks_2.swf 7.4 MB
Games/Vortex Point Series/Vortex Point 3.swf 7.3 MB
Games/Teddys Excellent Adventure.swf 7.3 MB
Games/mrsplibox.swf 7.3 MB
Games/Ultimate Gamer Challenge.swf 7.3 MB
Games/Gun Mayhem Redux.swf 7.3 MB
Games/Sieger Series/sieger_2_age_of_gunpowder.swf 7.3 MB
Games/bitzyblitz.swf 7.2 MB
Games/bearbarians.swf 7.2 MB
Games/the_bearbarians.swf 7.2 MB
Games/Aether.swf 7.2 MB
Games/ZS Dead Detective Series/Zombie Society - Dead Detective.swf 7.2 MB
Games/Infectonator Series/infectonator_2.swf 7.2 MB
Games/Submachine Series/Submachine 8 the Plan.swf 7.2 MB
Games/Hobo Series/hobo_7_Heaven.swf 7.2 MB
Games/Arsenal.swf 7.2 MB
Games/kingsgame.swf 7.2 MB
Games/How Smart Are You.swf 7.2 MB
Games/engage.swf 7.2 MB
Games/abduction.swf 7.2 MB
Games/Thing-Thing Series/thing-thing_3.swf 7.2 MB
Games/themostwantedbandito.swf 7.2 MB
Games/fort blaster ahoy there.swf 7.2 MB
Games/rocketpets.swf 7.1 MB
Games/red-extinction.swf 7.1 MB
Games/A Game About Game Literacy.swf 7.1 MB
Games/BubbleQuod.swf 7.1 MB
Games/Awesome_Pirates.swf 7.1 MB
Games/Sushi Cat Series/sushi_cat_2.swf 7.1 MB
Games/Shotgun_vs_Zombies.swf 7.1 MB
Games/mustache attack.swf 7.1 MB
Games/Time Swap A Look To The Past.swf 7.1 MB
Games/Castle Quest.swf 7.1 MB
Games/let_s_journey.swf 7.1 MB
Games/zomgies2.swf 7.1 MB
Games/thewok.swf 7.0 MB
Games/portal_the_flash_version.swf 7.0 MB
Games/tombdefender.swf 7.0 MB
Games/Forgotten Hill Series/Forgotten Hill. Memento Love Beyond.swf 7.0 MB
Games/mushroom madness 3.swf 7.0 MB
Games/collapseit2.swf 7.0 MB
Games/ZS Dead Detective Series/ZS Dead Detective - A Curse In Disguise.swf 7.0 MB
Games/celsium.swf 7.0 MB
Games/Whack Series/whack_the_creeps.swf 7.0 MB
Games/Hostage_Crisis.swf 7.0 MB
Games/Sift Heads Series/sift_heads_world-act_6.swf 7.0 MB
Games/nelly.swf 7.0 MB
Games/Knightmare_Tower.swf 6.9 MB
Games/chibi_knight.swf 6.9 MB
Games/Puzzatales!.swf 6.9 MB
Games/run_2_live.swf 6.9 MB
Games/zombudoy 2 the holiday.swf 6.9 MB
Games/dummyneverfails2.swf 6.9 MB
Games/6 Differences.swf 6.9 MB
Games/awesomeplanes.swf 6.9 MB
Games/loot_heroes.swf 6.9 MB
Games/Shotfirer.swf 6.9 MB
Games/ZS Dead Detective Series/Dead Detective vs Nine Deaths Cat.swf 6.9 MB
Games/The Great Bazooki.swf 6.9 MB
Games/magic orbs.swf 6.9 MB
Games/Blasting Agent.swf 6.9 MB
Games/adventure_time_-_jumping_finn.swf 6.9 MB
Games/primary.swf 6.8 MB
Games/Kill the Plumber 2.swf 6.8 MB
Games/Blocks With Letters On 4.swf 6.8 MB
Games/Deadly Neighbors 2.swf 6.8 MB
Games/Hobo Series/hobo_6_hell.swf 6.8 MB
Games/Jellydad Hero.swf 6.8 MB
Games/Creepos Tales 2.swf 6.8 MB
Games/The Fog Fall 2.swf 6.8 MB
Games/yves.swf 6.8 MB
Games/cactus-mccoy.swf 6.8 MB
Games/freedom-tower.swf 6.8 MB
Games/Caravaneer.swf 6.7 MB
Games/Thing-Thing Series/Thing-Thing Arena 3.swf 6.7 MB
Games/Vortex Point Series/Vortex Point 8.swf 6.7 MB
Games/Sushi Cat Series/sushi_cat_the_honeymoon.swf 6.7 MB
Games/thepaintgunner.swf 6.7 MB
Games/car eats car 2 deluxe.swf 6.7 MB
Games/car eats car 2.swf 6.7 MB
Games/Viktor the Nth.swf 6.7 MB
Games/notinmydungeon.swf 6.7 MB
Games/turbo kids.swf 6.7 MB
Games/escapefromnightmare.swf 6.7 MB
Games/300milestopigsland.swf 6.7 MB
Games/The_Peacekeeper.swf 6.7 MB
Games/Adventure Story.swf 6.7 MB
Games/epicbattlefantasyadventurestory.swf 6.7 MB
Games/Dont Escape.swf 6.6 MB
Games/nightflies.swf 6.6 MB
Games/Knightfall.swf 6.6 MB
Games/awesome_run.swf 6.6 MB
Games/Zombie_Fight_Club.swf 6.6 MB
Games/creativelycomplicated.swf 6.6 MB
Games/mad-day.swf 6.6 MB
Games/the adventures of dear explorer.swf 6.6 MB
Games/K.O.L.M. 2.swf 6.6 MB
Games/Morbid - Chapter 1.swf 6.6 MB
Games/villainous.swf 6.6 MB
Games/2112_cooperation_series/2112_cooperation_chapter_4.swf 6.6 MB
Games/Daymare Series/daymarecat.swf 6.6 MB
Games/The Farm.swf 6.5 MB
Games/pre-civilization_marble_age.swf 6.5 MB
Games/epic_boss_fighter.swf 6.5 MB
Games/Sneak Thief Series/Sneak Thief 4.swf 6.5 MB
Games/Peacefree Tactical Warfare.swf 6.5 MB
Games/Road Of Fury 2.swf 6.5 MB
Games/Sneak Thief Series/Sneak Thief 5.swf 6.5 MB
Games/alien_transporter.swf 6.5 MB
Games/Amil.swf 6.5 MB
Games/Roly-Poly Series/roly-poly_cannon_bloody_monsters_pack_2.swf 6.5 MB
Games/Casual Space.swf 6.5 MB
Games/Cube Escape Series/Cube Escape_ Case 23.swf 6.5 MB
Games/gangsta_bean.swf 6.4 MB
Games/Alice is dead 2.swf 6.4 MB
Games/Age of Wonder - The Lost Scrolls.swf 6.4 MB
Games/Knights_vs_Zombies.swf 6.4 MB
Games/William and Sly.swf 6.4 MB
Games/ClickPLAY series/clickplayquickfire3.swf 6.4 MB
Games/rockyrider2.swf 6.4 MB
Games/alienhominidxtreme.swf 6.4 MB
Games/Shift Series/Alt Shift Lite Edition.swf 6.4 MB
Games/buildingdemolisher.swf 6.4 MB
Games/commando.swf 6.4 MB
Games/Feed Us Series/feed_us_-_lost_island.swf 6.4 MB
Games/allweneedisbrainlevelpack.swf 6.4 MB
Games/makingmonkeys.swf 6.4 MB
Games/Tower of the Archmage.swf 6.4 MB
Games/accurateboy.swf 6.4 MB
Games/Bigotilyo.swf 6.4 MB
Games/ihave1day.swf 6.4 MB
Games/alaskan-adversary.swf 6.4 MB
Games/Bazooka Boy Series/bazookaboy2.swf 6.4 MB
Games/wolverine_tokyo_fury.swf 6.4 MB
Games/zombie_madness_-_the_awakening.swf 6.3 MB
Games/Barons_Gate.swf 6.3 MB
Games/Hobo Series/hobo_4_total_war.swf 6.3 MB
Games/Snail Bob Series/snail_bob_4_space.swf 6.3 MB
Games/StrikeForce Kitty Series/strikeforce_kitty_league.swf 6.3 MB
Games/Mushroom Madness 2.swf 6.3 MB
Games/aurora.swf 6.3 MB
Games/crystal runner.swf 6.3 MB
Games/shorties_s_kingdom 2.swf 6.2 MB
Games/Beard Guy Goes Surfing.swf 6.2 MB
Games/Red Ball 4 (vol.2).swf 6.2 MB
Games/Super Sneak.swf 6.2 MB
Games/kit and the octopod.swf 6.2 MB
Games/intospace.swf 6.2 MB
Games/Sift Heads Series/sift_heads_world_act_3.swf 6.2 MB
Games/volcania.swf 6.2 MB
Games/ZS Dead Detective Series/ZS Dead Detective - Roving Eyes.swf 6.2 MB
Games/worldofmutants.swf 6.2 MB
Games/Feed Us Series/feed_us_xmas_xpansion.swf 6.2 MB
Games/The Enchanted Cave.swf 6.2 MB
Games/paintworld2.swf 6.2 MB
Games/The Great House Escape.swf 6.2 MB
Games/Riddle School Series/riddle_school_4.swf 6.2 MB
Games/dinopanic.swf 6.2 MB
Games/Mystery IQ Test.swf 6.1 MB
Games/BoxHead Series/boxhead_the_christmas_nightmare.swf 6.1 MB
Games/dinoshift.swf 6.1 MB
Games/retriever.swf 6.1 MB
Games/freeway-fury.swf 6.1 MB
Games/Snail Bob Series/snail_bob_2.swf 6.1 MB
Games/Where is series/where_is_2011.swf 6.1 MB
Games/ZS Dead Detective Series/ZS Dead Detective - Brain Drain.swf 6.1 MB
Games/drawfender.swf 6.1 MB
Games/2112_cooperation_series/2112_cooperation_chapter_2.swf 6.1 MB
Games/Jo99 games/hospital 46.swf 6.1 MB
Games/rot gut.swf 6.1 MB
Games/ZS Dead Detective Series/ZS Dead Detective - Murder Case.swf 6.1 MB
Games/Ricochet Kills Series/ricochet_kills_4.swf 6.1 MB
Games/Hero in the Ocean.swf 6.1 MB
Games/super_muzhik_2.swf 6.1 MB
Games/renegades.swf 6.1 MB
Games/Sift Heads Series/sift_heads_cartels_-_act_2.swf 6.0 MB
Games/Searching for the Elephant.swf 6.0 MB
Games/roll_roll_pirate.swf 6.0 MB
Games/supersantabomber.swf 6.0 MB
Games/Earn To Die Series/earn_to_die_2012_part_2.swf 6.0 MB
Games/City Siege Series/City Siege 3 FUBAR Level Pack.swf 6.0 MB
Games/The Dreamerz.swf 6.0 MB
Games/zombiesincentralpark.swf 6.0 MB
Games/the-gun-game-2.swf 6.0 MB
Games/like_vampire_like_son.swf 6.0 MB
Games/Slime Quest.swf 6.0 MB
Games/Sota.swf 6.0 MB
Games/Amigo Pancho Series/Amigo Pancho.swf 6.0 MB
Games/briker2.swf 6.0 MB
Games/Nevermore 3.swf 6.0 MB
Games/yummynuts2.swf 6.0 MB
Games/ink`s_sleep.swf 6.0 MB
Games/Monster Legions.swf 6.0 MB
Games/ClickPLAY series/clickplayrainbow2.swf 6.0 MB
Games/gun mayhem.swf 6.0 MB
Games/Zombie Typocalypse.swf 6.0 MB
Games/tokyoguineapop.swf 5.9 MB
Games/Frantic 2.swf 5.9 MB
Games/Sift Heads Series/sift_heads_world_act_2.swf 5.9 MB
Games/Retro Unicorn Attack.swf 5.9 MB
Games/dragon_s_gold.swf 5.9 MB
Games/Wrap_Attack.swf 5.9 MB
Games/days 2 die.swf 5.9 MB
Games/The Scorpion Box.swf 5.9 MB
Games/Tiny Dangerous Dungeons.swf 5.9 MB
Games/the_pretender_part_two.swf 5.9 MB
Games/The Next Floor.swf 5.9 MB
Games/evilforest.swf 5.9 MB
Games/zombocalypse.swf 5.9 MB
Games/Meat boy - Map Pack.swf 5.9 MB
Games/13_more_days_in_hell.swf 5.9 MB
Games/bugongo.swf 5.9 MB
Games/flawed_dimension.swf 5.9 MB
Games/disasterwillstrike2.swf 5.9 MB
Games/Awesome Seaquest.swf 5.9 MB
Games/transmorpher.swf 5.9 MB
Games/House of Dead Ninjas.swf 5.9 MB
Games/Get Home.swf 5.9 MB
Games/awesomecars.swf 5.8 MB
Games/robokill_-_titan_prime.swf 5.8 MB
Games/Madness Series/Madness Premeditation.swf 5.8 MB
Games/musequest.swf 5.8 MB
Games/chancealot.swf 5.8 MB
Games/sanguine.swf 5.8 MB
Games/ragdollachievement.swf 5.8 MB
Games/Deadly Venom SA.swf 5.8 MB
Games/magicsteel.swf 5.8 MB
Games/Dangerous Dungeons.swf 5.8 MB
Games/anti_terrorist rush.swf 5.8 MB
Games/The Trader of Stories.swf 5.8 MB
Games/saving the company.swf 5.8 MB
Games/Super Crazy Guitar Maniac Deluxe Series/super_crazy_guitar_maniac_deluxe_2.swf 5.8 MB
Games/wizardwalls.swf 5.8 MB
Games/ZS Dead Detective Series/ZS Dead Detective - Graves Secrets.swf 5.8 MB
Games/Feed Us Series/feed_us_4.swf 5.8 MB
Games/quietus2.swf 5.8 MB
Games/chaos-faction.swf 5.8 MB
Games/Dale & Peakot.swf 5.8 MB
Games/fractured.swf 5.8 MB
Games/experimentalshooter.swf 5.8 MB
Games/flash_s_bounty.swf 5.8 MB
Games/Space Incident.swf 5.7 MB
Games/Hitstick Series/hitstick_rebirth.swf 5.7 MB
Games/awesome_tanks.swf 5.7 MB
Games/4 differences.swf 5.7 MB
Games/Submachine Series/Submachine 7 the Core.swf 5.7 MB
Games/Me and My Dinosaur.swf 5.7 MB
Games/thefirsthero.swf 5.7 MB
Games/Warfare 1917.swf 5.7 MB
Games/Bright In The Screen.swf 5.7 MB
Games/Hobo Series/hobo_3_wanted.swf 5.7 MB
Games/howdareyou.swf 5.7 MB
Games/drawfender_level_pack.swf 5.7 MB
Games/Earn To Die Series/earn_to_die_2012.swf 5.7 MB
Games/nuclearplant.swf 5.7 MB
Games/BoxHead Series/boxhead_biever_and_baby.swf 5.7 MB
Games/Submachine Series/submachine7.swf 5.7 MB
Games/Forgotten Hill Series/Forgotten Hill. Memento run run little horse.swf 5.6 MB
Games/Madness Series/madness-regent.swf 5.6 MB
Games/City Siege Series/City_Siege_4_Alien_Siege.swf 5.6 MB
Games/berzerk_ball.swf 5.6 MB
Games/Berzerk Ball Homerun in Berzerk Land.swf 5.6 MB
Games/The Sniper 2.swf 5.6 MB
Games/Kill the Plumber.swf 5.6 MB
Games/Back in Time 2.swf 5.6 MB
Games/themagneticcat.swf 5.6 MB
Games/diamond_hollow_2.swf 5.6 MB
Games/super-mega-bot.swf 5.6 MB
Games/robots cant think.swf 5.6 MB
Games/rogue-soul.swf 5.6 MB
Games/Sift Heads Series/sift_heads_world_act_1.swf 5.6 MB
Games/red_rogue.swf 5.6 MB
Games/i_dont_even_game.swf 5.6 MB
Games/You Only Live Once.swf 5.6 MB
Games/Dragon Boy.swf 5.6 MB
Games/the scene of the crime.swf 5.5 MB
Games/car eats car.swf 5.5 MB
Games/Meat Boy.swf 5.5 MB
Games/escape_from_26.swf 5.5 MB
Games/ruthless_pandas.swf 5.5 MB
Games/Midnight Hunter.swf 5.5 MB
Games/Avant-Garde.swf 5.5 MB
Games/StrikeForce Kitty Series/strikeforce_kitty_last_stand.swf 5.5 MB
Games/flaming_zombooka_3.swf 5.5 MB
Games/truck_loader_5.swf 5.5 MB
Games/Temple of the Spear.swf 5.5 MB
Games/Transmorpher 3.swf 5.5 MB
Games/A Stroll in Space.swf 5.5 MB
Games/dino run marathon of doom.swf 5.5 MB
Games/snowdrift.swf 5.5 MB
Games/intrusion.swf 5.5 MB
Games/Inquisitive Dave.swf 5.5 MB
Games/Arcane_Weapon.swf 5.5 MB
Games/deadly_venom_3.swf 5.5 MB
Games/mushroomer.swf 5.5 MB
Games/Roly-Poly Series/rolypolyeliminator2.swf 5.5 MB
Games/Brawlin' Sailor.swf 5.5 MB
Games/war_card.swf 5.5 MB
Games/Darktopia.swf 5.5 MB
Games/StormWinds. The Mary Reed Chronicles.swf 5.4 MB
Games/chef_day.swf 5.4 MB
Games/soom.swf 5.4 MB
Games/the_world_s_hardest_game_4.swf 5.4 MB
Games/Red Ball 4 (vol.3).swf 5.4 MB
Games/As I Lay Dying!.swf 5.4 MB
Games/blosics3.swf 5.4 MB
Games/Suspense II.swf 5.4 MB
Games/10morebullets.swf 5.4 MB
Games/Dragon's Quest.swf 5.4 MB
Games/madburger.swf 5.4 MB
Games/allweneedisbrain2.swf 5.4 MB
Games/lasercannon3.swf 5.4 MB
Games/Dakota Winchesters Adventures.swf 5.4 MB
Games/Town of Fears.swf 5.4 MB
Games/the_pretender_part_one.swf 5.4 MB
Games/Farm-Express-3.swf 5.4 MB
Games/kamikazepigs.swf 5.4 MB
Games/crashtv.swf 5.4 MB
Games/zomblast.swf 5.4 MB
Games/learntofly2.swf 5.4 MB
Games/the_gun_game_redux.swf 5.4 MB
Games/Awesome Conquest.swf 5.4 MB
Games/Roads_of_Rome_3.swf 5.4 MB
Games/commit5.swf 5.4 MB
Games/slowandblow.swf 5.3 MB
Games/Submachine Series/Submachine 2 the lighthouse.swf 5.3 MB
Games/a_goody_life.swf 5.3 MB
Games/valthirian-arc.swf 5.3 MB
Games/Wake Up the Box Series/Wake Up the Box 5.swf 5.3 MB
Games/shadow regiment.swf 5.3 MB
Games/Coinbox Hero.swf 5.3 MB
Games/Vehicles Level Pack.swf 5.3 MB
Games/wrath_of_zombies.swf 5.3 MB
Games/dusk.swf 5.3 MB
Games/Flood Runner Series/floodrunner4.swf 5.3 MB
Games/Battalion Vengeance.swf 5.3 MB
Games/themostwantedbandito2.swf 5.2 MB
Games/Thing-Thing Series/Thing-Thing Arena 2.swf 5.2 MB
Games/grannystrikesback.swf 5.2 MB
Games/talesworthadventurethelostartifacts.swf 5.2 MB
Games/aggro.swf 5.2 MB
Games/happydeadfriendsplayerspack.swf 5.2 MB
Games/happydeadfriends.swf 5.2 MB
Games/canyon shooter.swf 5.2 MB
Games/superpuzzleplatformer.swf 5.2 MB
Games/free_icecream.swf 5.2 MB
Games/swiftturn2.swf 5.2 MB
Games/binga.swf 5.2 MB
Games/City Siege Series/city_siege_-_sniper.swf 5.2 MB
Games/Reincarnation Series/Reincarnation The Clergy Of Unholy.swf 5.2 MB
Games/Creepos Tales.swf 5.2 MB
Games/Battalion Ghosts.swf 5.2 MB
Games/Comic_Book_Cody.swf 5.2 MB
Games/Amigo Pancho Series/Amigo Pancho 2 New York Party.swf 5.1 MB
Games/Robokill Trainer.swf 5.1 MB
Games/Hobo Series/hobo_2_prison_brawl.swf 5.1 MB
Games/BoxHead Series/boxhead_the_nightmare.swf 5.1 MB
Games/Laser Cannon 3 Levels Pack.swf 5.1 MB
Games/vexation.swf 5.1 MB
Games/driving_force_2.swf 5.1 MB
Games/ZS Dead Detective Series/ZS Dead Detective - Walls can Bleed.swf 5.1 MB
Games/driving_force.swf 5.1 MB
Games/The Scene of the Crime Dream of Murder.swf 5.1 MB
Games/franknslime.swf 5.1 MB
Games/driving_force_4.swf 5.1 MB
Games/The Valley Rule.swf 5.1 MB
Games/driving_force_3.swf 5.1 MB
Games/blosics2levelpack.swf 5.1 MB
Games/Mafia - The Betrayer.swf 5.1 MB
Games/Vortex Point Series/vortex_point_2.swf 5.1 MB
Games/dangerous treasures.swf 5.1 MB
Games/zombie_incursion.swf 5.1 MB
Games/Smokin Barrels 2.swf 5.1 MB
Games/Mini_Commando.swf 5.1 MB
Games/Cowlorful.swf 5.1 MB
Games/bounzy2.swf 5.1 MB
Games/The Everloom.swf 5.0 MB
Games/concernedjoe.swf 5.0 MB
Games/13 Days in Hell.swf 5.0 MB
Games/Covert Front Series/Covert Front 2 station on the horizon.swf 5.0 MB
Games/alphaland.swf 5.0 MB
Games/Reincarnation Series/Reincarnation ADDO.swf 5.0 MB
Games/alienocalypse.swf 5.0 MB
Games/run_ninja_run_-_unexpected_road.swf 5.0 MB
Games/PaintWorld.swf 5.0 MB
Games/pursuitofhat2.swf 5.0 MB
Games/belialchapter2.5.swf 5.0 MB
Games/binga2.swf 5.0 MB
Games/transformers_escape.swf 5.0 MB
Games/jackoinhell2.swf 5.0 MB
Games/KripperZ.swf 5.0 MB
Games/Hobo Series/hobo.swf 5.0 MB
Games/RocketJump.swf 5.0 MB
Games/ClickPLAY series/clickplay-quickfire 2.swf 5.0 MB
Games/ClickPLAY series/clickplayquickfire1.swf 5.0 MB
Games/defence_of_the_portal.swf 4.9 MB
Games/road of fury.swf 4.9 MB
Games/Wheely Series/Wheely.swf 4.9 MB
Games/Deadly Venom 2 - Origins.swf 4.9 MB
Games/A small talk at the back of beyond.swf 4.9 MB
Games/truckloader4.swf 4.9 MB
Games/Fireboy & Watergirl Series/Fireboy & Watergirl in The Crystal Temple.swf 4.9 MB
Games/Notebook Wars Series/Notebook Space Wars.swf 4.9 MB
Games/Space is Key Christmas.swf 4.9 MB
Games/Defend_Your_Nuts_2.swf 4.9 MB
Games/zombie_pinball.swf 4.9 MB
Games/brave_shorties_2.swf 4.9 MB
Games/doodlegod2.swf 4.9 MB
Games/zombie_train.swf 4.9 MB
Games/The Elephant Collection/this-is-the-only-level 4.swf 4.9 MB
Games/Feed Us Series/feed_us_3.swf 4.9 MB
Games/Prophet.swf 4.9 MB
Games/mushbits2.swf 4.8 MB
Games/Talesworth Arena.swf 4.8 MB
Games/chocolate_rambo.swf 4.8 MB
Games/sticky_ninja_academy.swf 4.8 MB
Games/good daddy.swf 4.8 MB
Games/Sushi Cat Series/sushi_cat.swf 4.8 MB
Games/Sift Heads Series/sift_heads_4.swf 4.8 MB
Games/Infectonator Series/infectonator_hot_chase.swf 4.8 MB
Games/Finding Jacks Treasure.swf 4.8 MB
Games/Roly-Poly Series/Roly-Poly Cannon Bloody Monsters Pack.swf 4.8 MB
Games/City Siege Series/city_siege_3_jungle_siege.swf 4.8 MB
Games/vehicles3cartoons.swf 4.8 MB
Games/gogo gummo down in the dumps.swf 4.8 MB
Games/mushroom madness.swf 4.8 MB
Games/blosics2.swf 4.8 MB
Games/slumdog_billionaire.swf 4.8 MB
Games/firebug2.swf 4.8 MB
Games/The Sagittarian Series/The Sagittarian 4 Bayou.swf 4.8 MB
Games/Hey Wizard!.swf 4.8 MB
Games/collapseit.swf 4.8 MB
Games/zombiesituation.swf 4.8 MB
Games/pothead zombies.swf 4.8 MB
Games/wolverine_mrd_escape.swf 4.8 MB
Games/blym.swf 4.8 MB
Games/dinoshift2.swf 4.8 MB
Games/s_t_a_n_d.swf 4.8 MB
Games/mushbits.swf 4.7 MB
Games/Tequila Zombies.swf 4.7 MB
Games/super_squad.swf 4.7 MB
Games/space oddity 2.swf 4.7 MB
Games/Roads of Rome 2.swf 4.7 MB
Games/Buccaneer!.swf 4.7 MB
Games/The Gentleman.swf 4.7 MB
Games/sas_zombie_assault_2_-_insane_asylum.swf 4.7 MB
Games/zombie_at_the_gates.swf 4.7 MB
Games/Thing-Thing Series/Thing-Thing Arena.swf 4.7 MB
Games/lavaclimber.swf 4.7 MB
Games/frogout.swf 4.7 MB
Games/battle_golf.swf 4.7 MB
Games/mirror.swf 4.7 MB
Games/vehicles2.swf 4.7 MB
Games/air_transporter.swf 4.7 MB
Games/Thing-Thing Series/thing-thing_4.swf 4.7 MB
Games/thebullet.swf 4.7 MB
Games/400_years.swf 4.7 MB
Games/fearless.swf 4.7 MB
Games/Jo99 games/coma45.swf 4.7 MB
Games/zombie_trailer_park.swf 4.7 MB
Games/gunbot.swf 4.7 MB
Games/Cube Escape Series/Cube Escape_ The Mill.swf 4.7 MB
Games/Child of a Witch 1.swf 4.6 MB
Games/youarestillabox.swf 4.6 MB
Games/Level Editor Series/Level Editor 4.swf 4.6 MB
Games/roads_of_rome.swf 4.6 MB
Games/Ricochet Kills Series/ricochet Skull hunter.swf 4.6 MB
Games/a_night_in_crazyville.swf 4.6 MB
Games/Zombie Survival - Outbreak.swf 4.6 MB
Games/Shadez 3 The Moon Miners.swf 4.6 MB
Games/Sieger Series/sieger.swf 4.6 MB
Games/zipzip secret dimension.swf 4.6 MB
Games/deadconvoy.swf 4.6 MB
Games/yummynuts.swf 4.6 MB
Games/Use Boxmen.swf 4.6 MB
Games/balloons_vs_zombies.swf 4.6 MB
Games/BoxHead Series/boxhead_bounty_hunter.swf 4.6 MB
Games/Level Editor Series/level-editor.swf 4.6 MB
Games/viaductdesigner.swf 4.5 MB
Games/Snail Bob Series/snail_bob.swf 4.5 MB
Games/aetherpunk.swf 4.5 MB
Games/Necronator.swf 4.5 MB
Games/warpgame.swf 4.5 MB
Games/viking-valor.swf 4.5 MB
Games/Deep Sleep Series/deep sleep.swf 4.5 MB
Games/Battalion Skirmish.swf 4.5 MB
Games/lightquest.swf 4.5 MB
Games/diggy.swf 4.5 MB
Games/gingerbread_circus_2.swf 4.5 MB
Games/ClickPLAY series/clickplayrainbow.swf 4.5 MB
Games/Finders Seekers.swf 4.5 MB
Games/demonsdownunder.swf 4.5 MB
Games/cyclomaniacs.swf 4.5 MB
Games/the_last_stand.swf 4.5 MB
Games/abubathealien.swf 4.5 MB
Games/a Trashy Love Story.swf 4.5 MB
Games/insectonator_zombie_mode.swf 4.5 MB
Games/Child of a Witch 3.swf 4.5 MB
Games/sift_renegade.swf 4.4 MB
Games/Notebook Wars Series/notebookwars3.swf 4.4 MB
Games/battalion_commander.swf 4.4 MB
Games/dibbles-2-winter-woe.swf 4.4 MB
Games/sift_renegade_3_expansion_defiance.swf 4.4 MB
Games/space oddity.swf 4.4 MB
Games/snakesquad.swf 4.4 MB
Games/liquid.swf 4.4 MB
Games/zombie balloon heads 2.swf 4.4 MB
Games/Roly-Poly Series/Roly-Poly Cannon 3.swf 4.4 MB
Games/Blobs Story 2.swf 4.4 MB
Games/airbattle2.swf 4.4 MB
Games/Castle Cat 3.swf 4.4 MB
Games/jellytruck.swf 4.4 MB
Games/acornstory.swf 4.4 MB
Games/vex_2.swf 4.4 MB
Games/absorbed_2.swf 4.3 MB
Games/portal2d.swf 4.3 MB
Games/Sherlock Holmes - The Tea Shop Murder Mystery.swf 4.3 MB
Games/Mining_Truck_2_Trolley_Transport.swf 4.3 MB
Games/chief.swf 4.3 MB
Games/Go Go Plant 2.swf 4.3 MB
Games/Lee Lee's Quest.swf 4.3 MB
Games/Pre-Civilization Stone Age.swf 4.3 MB
Games/xmastrollcannon.swf 4.3 MB
Games/xonix3dlevelspack.swf 4.3 MB
Games/Deadly Neighbours.swf 4.3 MB
Games/Child of a Witch 2.swf 4.3 MB
Games/jim_loves_mary_2.swf 4.3 MB
Games/Reincarnation Series/Reincarnation Let The Evil Times Roll.swf 4.3 MB
Games/crazyhand.swf 4.3 MB
Games/santa run 3.swf 4.3 MB
Games/thelegendofthegoldenrobot.swf 4.3 MB
Games/dibbles_3.swf 4.2 MB
Games/Notebook Wars Series/Notebook Space Wars 2.swf 4.2 MB
Games/Roly-Poly Series/roly-polycannon2.swf 4.2 MB
Games/This is not a minimalist game.swf 4.2 MB
Games/franticfrigates.swf 4.2 MB
Games/atomicpuzzle.swf 4.2 MB
Games/Butterfly Fantasy.swf 4.2 MB
Games/Anniversary Game.swf 4.2 MB
Games/focus.swf 4.2 MB
Games/verge.swf 4.2 MB
Games/Dibbles 4 A Christmas Crisis.swf 4.2 MB
Games/Where is series/where_is_2012.swf 4.2 MB
Games/brave_shorties.swf 4.2 MB
Games/Kill Your Nerves.swf 4.2 MB
Games/continuity.swf 4.2 MB
Games/vexation_2.swf 4.2 MB
Games/99 Bricks the Legend of Garry.swf 4.2 MB
Games/Roly-Poly Series/Roly-Poly Monsters.swf 4.2 MB
Games/firebug.swf 4.2 MB
Games/all that matters.swf 4.2 MB
Games/matchdayofthedead.swf 4.2 MB
Games/butterfly_fantasy_3.swf 4.1 MB
Games/Sift Heads Series/sift_heads_assault_3.swf 4.1 MB
Games/maxploder.swf 4.1 MB
Games/birdblast.swf 4.1 MB
Games/yellow_puzzle.swf 4.1 MB
Games/sharp_trigger.swf 4.1 MB
Games/Reincarnation Series/reincarnationatasteofevil.swf 4.1 MB
Games/minicraft.swf 4.1 MB
Games/Cuboy Series/cuboy hot pants.swf 4.1 MB
Games/Slime's Turn.swf 4.1 MB
Games/sift_renegade_3.swf 4.1 MB
Games/roadkill_revenge.swf 4.1 MB
Games/detective_grimoire.swf 4.1 MB
Games/Eastward Quest.swf 4.1 MB
Games/Shifter.swf 4.1 MB
Games/Covert Front Series/covert_front.swf 4.1 MB
Games/Depict1.swf 4.1 MB
Games/fantasy carnage.swf 4.1 MB
Games/rayandcooper.swf 4.1 MB
Games/Nightmares The Adventures Series/nightmares_the_adventure_5.swf 4.0 MB
Games/Infinity Inc.swf 4.0 MB
Games/give_up.swf 4.0 MB
Games/Earn To Die Series/earn_to_die.swf 4.0 MB
Games/vex.swf 4.0 MB
Games/Notebook Wars Series/notebookwars2.swf 4.0 MB
Games/slingfire.swf 4.0 MB
Games/senya_and_oscar_the_fearless_adventure.swf 4.0 MB
Games/CP6.swf 4.0 MB
Games/Boom Town.swf 4.0 MB
Games/You Are A Box.swf 4.0 MB
Games/oneandonestory.swf 4.0 MB
Games/allweneedisbrain.swf 4.0 MB
Games/Earl Grey and This Rupert Guy.swf 4.0 MB
Games/lasttown.swf 4.0 MB
Games/quantumcorps.swf 4.0 MB
Games/Building Rush.swf 4.0 MB
Games/Home Sheep Home Series/Home Sheep Home.swf 4.0 MB
Games/circus.swf 4.0 MB
Games/zombies_vs_penguins.swf 4.0 MB
Games/GregManiacs.swf 4.0 MB
Games/Solipskier.swf 4.0 MB
Games/battleofundermountain.swf 4.0 MB
Games/Jim Loves Mary.swf 4.0 MB
Games/shape_fold_animals.swf 4.0 MB
Games/myfriendpedro.swf 4.0 MB
Games/tinysquad.swf 4.0 MB
Games/thehuntingofthesnark.swf 4.0 MB
Games/idle_sword.swf 4.0 MB
Games/Fireboy & Watergirl Series/fireboy & watergirl 2 in the light temple.swf 4.0 MB
Games/johnny_upgrade.swf 4.0 MB
Games/Sift Heads Series/sift_heads_5.swf 4.0 MB
Games/sas zombie assault 2.swf 4.0 MB
Games/dino run escape extinction.swf 3.9 MB
Games/william_the_conqueror.swf 3.9 MB
Games/Level Editor Series/level_editor_3.swf 3.9 MB
Games/bustabrain2.swf 3.9 MB
Games/sling.swf 3.9 MB
Games/blobescapefromlab16b.swf 3.9 MB
Games/angrychubby.swf 3.9 MB
Games/flamingzombooka2levelpack.swf 3.9 MB
Games/iquitmustdash.swf 3.9 MB
Games/a_second_chance.swf 3.9 MB
Games/jackthezombie.swf 3.9 MB
Games/disasterwillstrike.swf 3.9 MB
Games/billythepilot.swf 3.9 MB
Games/Fireboy & Watergirl Series/fireboy & watergirl in the ice temple.swf 3.9 MB
Games/eleventhhour.swf 3.9 MB
Games/plazma_burst_forward_to_the_past.swf 3.9 MB
Games/StrikeForce Kitty Series/strikeforce_kitty.swf 3.9 MB
Games/Pick & Dig 2.swf 3.9 MB
Games/rew.swf 3.9 MB
Games/Guardian Rock.swf 3.9 MB
Games/Shameless clone 2.swf 3.8 MB
Games/spaceship.swf 3.8 MB
Games/Reincarnation Series/Reincarnation In The Name Of Evil.swf 3.8 MB
Games/Bustabrain.swf 3.8 MB
Games/Puzzle Legends.swf 3.8 MB
Games/flaming_zombooka_2.swf 3.8 MB
Games/Suspense.swf 3.8 MB
Games/e7.swf 3.8 MB
Games/android.swf 3.8 MB
Games/atomicpuzzle2.swf 3.8 MB
Games/egg_knight.swf 3.8 MB
Games/Xonix 3d.swf 3.8 MB
Games/Submachine Series/submachine4-thelab.swf 3.8 MB
Games/ClickPLAY series/clickplaytime-4.swf 3.8 MB
Games/dragon_quest.swf 3.8 MB
Games/ClickPLAY series/clickplaytime-2.swf 3.8 MB
Games/City Siege Series/city_siege_2_-_resort_siege.swf 3.8 MB
Games/Zombiewest_There_and_Back_Again.swf 3.8 MB
Games/zombie_tactics.swf 3.8 MB
Games/floodedvillage.swf 3.8 MB
Games/state_of_zombies_2.swf 3.7 MB
Games/Hitstick Series/Hitstick 5.swf 3.7 MB
Games/pursuitofhat.swf 3.7 MB
Games/Back in Time.swf 3.7 MB
Games/zombie balloon heads Halloween.swf 3.7 MB
Games/The Guardian. Chapter 1.swf 3.7 MB
Games/me and the key.swf 3.7 MB
Games/zomgies.swf 3.7 MB
Games/dummyneverfails.swf 3.7 MB
Games/Small Arms War.swf 3.7 MB
Games/earthbound.swf 3.7 MB
Games/Butterfly fantasy2.swf 3.7 MB
Games/Psychout.swf 3.7 MB
Games/The Elephant Collection/elephant_quest.swf 3.7 MB
Games/Trapped 2.swf 3.7 MB
Games/Theropods.swf 3.7 MB
Games/The Fog Fall.swf 3.7 MB
Games/johnny_rocketfingers.swf 3.6 MB
Games/wickedrider.swf 3.6 MB
Games/zombies_inc.swf 3.6 MB
Games/bonsai_worlds.swf 3.6 MB
Games/Sugar, Sugar - The Christmas Special.swf 3.6 MB
Games/kleinecastle.swf 3.6 MB
Games/doodle_devil.swf 3.6 MB
Games/Understanding Games Episode 4.swf 3.6 MB
Games/Vortex Point Series/Vortex Point.swf 3.6 MB
Games/belial_chapter_1.swf 3.6 MB
Games/Sift Heads Series/sift_heads_2.swf 3.6 MB
Games/anika_s_odyssey.swf 3.6 MB
Games/Ricochet Kills Series/ricochet_kills_3.swf 3.6 MB
Games/jackoinhell.swf 3.6 MB
Games/A Ghostly Journey.swf 3.6 MB
Games/Rocket Santa 2.swf 3.6 MB
Games/absorbed.swf 3.6 MB
Games/animaloffice.swf 3.6 MB
Games/crush_the_castle_players_pack.swf 3.6 MB
Games/Whack Series/dont_whack_your_boss.swf 3.6 MB
Games/Shift Series/shift_4.swf 3.5 MB
Games/Bloons Series/Bloons 2.swf 3.5 MB
Games/zombiesinyourbackyard.swf 3.5 MB
Games/The Impossible Quiz - Fan Edition.swf 3.5 MB
Games/Stick of Death 2.swf 3.5 MB
Games/Sift Heads Series/sift_heads_assault_2.swf 3.5 MB
Games/Escape from Jay is Games.swf 3.5 MB
Games/Tickets 4Love.swf 3.5 MB
Games/me and the key 2.swf 3.5 MB
Games/Bat Country.swf 3.5 MB
Games/the-illusionists-dream.swf 3.5 MB
Games/frantic.swf 3.5 MB
Games/Shark Series/miamishark.swf 3.5 MB
Games/Big Pixel Zombies.swf 3.5 MB
Games/recursion.swf 3.5 MB
Games/Boss 101.swf 3.5 MB
Games/supervillainy.swf 3.5 MB
Games/warface.swf 3.5 MB
Games/Flood Runner Series/flood_runner_armageddon.swf 3.5 MB
Games/Whack Series/whack_your_boss_17ways.swf 3.5 MB
Games/Ragdoll Cannon Series/ragdollcannon4.swf 3.5 MB
Games/Dummy Never Fails Community.swf 3.4 MB
Games/unfreezeme2.swf 3.4 MB
Games/ageofwonder.swf 3.4 MB
Games/Balls in Space.swf 3.4 MB
Games/Pretentious Game Series/Pretentious Game 5.swf 3.4 MB
Games/zombie balloon heads 3.swf 3.4 MB
Games/Fortune Hunter Wrath of Anubis.swf 3.4 MB
Games/Pick & Dig 3.swf 3.4 MB
Games/Hitstick Series/hitstick6.swf 3.4 MB
Games/catastrophi.swf 3.4 MB
Games/canabalt.swf 3.4 MB
Games/thecompanyofmyself.swf 3.4 MB
Games/montreal mobility.swf 3.4 MB
Games/Hitstick Series/Hitstick 4 International Killer.swf 3.4 MB
Games/agentb10 3.swf 3.4 MB
Games/Feed Us Series/feed_us_2.swf 3.4 MB
Games/lab.swf 3.4 MB
Games/Monsterland Series/Monsterland 4. One more Junior.swf 3.4 MB
Games/katwalk.swf 3.4 MB
Games/Galaxy Jumper.swf 3.3 MB
Games/The Elephant Collection/Achievement Unlocked 2.swf 3.3 MB
Games/Choose Your Weapon Series/Choose Your Weapon 3.swf 3.3 MB
Games/D-Day Defender.swf 3.3 MB
Games/unfreezeme.swf 3.3 MB
Games/Antichromatic.swf 3.3 MB
Games/caesar_s_day_off.swf 3.3 MB
Games/my_friend_pedro_arena.swf 3.3 MB
Games/Understanding Games Episode 1.swf 3.3 MB
Games/upgradecomplete.swf 3.3 MB
Games/adagio.swf 3.3 MB
Games/counter_terror.swf 3.3 MB
Games/levelup.swf 3.3 MB
Games/Monsterland Series/Monsterland 3. Junior Returns.swf 3.3 MB
Games/Alice is dead.swf 3.3 MB
Games/City Siege Series/city_siege.swf 3.3 MB
Games/rollintot.swf 3.2 MB
Games/adralienday.swf 3.2 MB
Games/fancy_snowboarding.swf 3.2 MB
Games/Hummingbird Mind.swf 3.2 MB
Games/angelofthebattlefield2.swf 3.2 MB
Games/Submachine Series/Submachine 6 the edge.swf 3.2 MB
Games/Dogfight 2.swf 3.2 MB
Games/sheriffchase.swf 3.2 MB
Games/60s to Save the Queen.swf 3.2 MB
Games/lasercannon.swf 3.2 MB
Games/sift_renegade_2.swf 3.2 MB
Games/Hitstick Series/hitstick3.swf 3.2 MB
Games/Ricochet Kills Series/ricochet kills space.swf 3.2 MB
Games/Why Am I Dead.swf 3.2 MB
Games/The Henry Stickmen Collection/breaking_the_bank.swf 3.2 MB
Games/perspective.swf 3.2 MB
Games/zoo escape 2.swf 3.2 MB
Games/shadez_2_battle_for_earth.swf 3.2 MB
Games/Garden Gnome Carnage.swf 3.2 MB
Games/Red Code.swf 3.2 MB
Games/Deadly Road Trip.swf 3.1 MB
Games/Feed Us Series/feed_us.swf 3.1 MB
Games/Choose Your Weapon Series/choose your weapon1.swf 3.1 MB
Games/mechanicalcommando.swf 3.1 MB
Games/escapetohell.swf 3.1 MB
Games/ClickPLAY series/clickplay3.swf 3.1 MB
Games/zombiesmasher.swf 3.1 MB
Games/ClickPLAY series/clickplaytime-1_0.swf 3.1 MB
Games/wonderputt.swf 3.1 MB
Games/doodle_god.swf 3.1 MB
Games/vehicles.swf 3.1 MB
Games/vertical_drop_heroes.swf 3.1 MB
Games/fig8.swf 3.1 MB
Games/Ultimate Crab Battle.swf 3.1 MB
Games/Plumber Pickle.swf 3.1 MB
Games/automaton.swf 3.1 MB
Games/Ricochet Kills Series/ricochet_kills_3_level_pack.swf 3.1 MB
Games/jake_s_tough_break.swf 3.1 MB
Games/pipe_riders.swf 3.1 MB
Games/anti_terrorist_rush_2.swf 3.0 MB
Games/Diamond Hollow.swf 3.0 MB
Games/Sift Heads Series/sift_heads.swf 3.0 MB
Games/arcs.swf 3.0 MB
Games/infestor.swf 3.0 MB
Games/Compost.swf 3.0 MB
Games/modern_tanks.swf 3.0 MB
Games/zoo escape.swf 3.0 MB
Games/Ricochet Kills Series/ricochet kills siberia.swf 3.0 MB
Games/Nightmares The Adventures Series/nightmares_the_adventures_4_the_stolen_souvenir_of_rob_r.swf 3.0 MB
Games/killbot.swf 2.9 MB
Games/Crow in Hell Series/crow in hell - affliction.swf 2.9 MB
Games/aerorumble.swf 2.9 MB
Games/greenssurviveonlywhenredsdie.swf 2.9 MB
Games/Ragdoll Cannon Series/Ragdoll Cannon 2.swf 2.9 MB
Games/santa run 2.swf 2.9 MB
Games/myangel.swf 2.9 MB
Games/paperwars.swf 2.9 MB
Games/Reincarnation Series/reincarnationtheevilnextdoor.swf 2.9 MB
Games/Bloons Series/bloons_tower_defense_4.swf 2.9 MB
Games/Sift Heads Series/sift_heads_assault.swf 2.9 MB
Games/archersoath.swf 2.9 MB
Games/cabbagemaniac.swf 2.9 MB
Games/Why Am I Dead Rebirth.swf 2.9 MB
Games/Clear Vision Series/clear_vision.swf 2.9 MB
Games/Coloruid 2.swf 2.9 MB
Games/gemcaveadventure.swf 2.9 MB
Games/Coloruid.swf 2.9 MB
Games/Bombardment.swf 2.9 MB
Games/Blocks With Letters On.swf 2.8 MB
Games/me-and-the-key-3.swf 2.8 MB
Games/photonbaby.swf 2.8 MB
Games/packupthetoy.swf 2.8 MB
Games/Arcane The Stone Circle Series/Arcane The Stone Circle - Episode 8.swf 2.8 MB
Games/Hitstick Series/Hitstick2.swf 2.8 MB
Games/Cube Escape Series/Cube Escape_ Arles.swf 2.8 MB
Games/themanwiththeinvisibletrousers.swf 2.8 MB
Games/Ragdoll Cannon Series/ragdollcannon3.swf 2.8 MB
Games/airbornewars2.swf 2.8 MB
Games/bazookiasilentaffair.swf 2.8 MB
Games/Blocks With Letters On 3.swf 2.8 MB
Games/Submachine Series/Submachine FLF.swf 2.8 MB
Games/Pretentious Game Series/pretentious_game_4.swf 2.8 MB
Games/Blocks With Letters On 2.swf 2.8 MB
Games/Zombie Survival.swf 2.8 MB
Games/one_chance.swf 2.8 MB
Games/10 Bullets.swf 2.8 MB
Games/assembots.swf 2.8 MB
Games/Submachine Series/Submachine 32 chambers.swf 2.8 MB
Games/Sneak Thief Series/Sneak Thief - prime catch.swf 2.8 MB
Games/dad_n_me.swf 2.8 MB
Games/Nunchuck Charlie A Love Story.swf 2.7 MB
Games/Rock n Risk.swf 2.7 MB
Games/Wake Up the Box Series/wakeupthebox3.swf 2.7 MB
Games/Pick & Dig.swf 2.7 MB
Games/Choose Your Weapon Series/choose your weapon2.swf 2.7 MB
Games/ballsoflife.swf 2.7 MB
Games/Steppenwolf Series/steppenwolf_chapter_6_episode_4.swf 2.7 MB
Games/Bloons Series/bloons_super_monkey.swf 2.7 MB
Games/Dont Look Back.swf 2.7 MB
Games/adam_and_eve_3.swf 2.7 MB
Games/Loved.swf 2.7 MB
Games/adam_and_eve_2.swf 2.7 MB
Games/spikealovestory.swf 2.7 MB
Games/k.o.l.m.swf 2.7 MB
Games/give_up_robot.swf 2.7 MB
Games/zombie balloon heads.swf 2.7 MB
Games/the_great_bathroom_escape.swf 2.7 MB
Games/Reincarnation Series/Reincarnation Riley's Out Again.swf 2.7 MB
Games/Sneak Thief Series/Sneak Thief Triple Trouble.swf 2.7 MB
Games/13worms.swf 2.7 MB
Games/Pipol Smasher.swf 2.7 MB
Games/tower_breaker.swf 2.7 MB
Games/Ricochet Kills Series/ricochet kills 2 players pack.swf 2.7 MB
Games/anbot2.swf 2.7 MB
Games/Level Editor Series/leveleditor2.swf 2.7 MB
Games/BoxHead Series/boxhead_the_zombie_wars.swf 2.6 MB
Games/Gap Monsters.swf 2.6 MB
Games/Shorty Covers.swf 2.6 MB
Games/folds-origamigame.swf 2.6 MB
Games/Roly-Poly Series/ROLY-POLY Eliminator.swf 2.6 MB
Games/Monsterland Series/monsterland 2. junior revenge.swf 2.6 MB
Games/Reincarnation Series/reincarnationallhallowsevil.swf 2.6 MB
Games/Can You Escape Love.swf 2.6 MB
Games/zombies_took_my_daughter.swf 2.6 MB
Games/Raider Episode 1.swf 2.6 MB
Games/moonwaltz.swf 2.6 MB
Games/omnomzombies.swf 2.6 MB
Games/The Adventures of Zomboy.swf 2.6 MB
Games/newspaperboy2.swf 2.6 MB
Games/wearefriends.swf 2.6 MB
Games/Notebook Wars Series/notebookwars.swf 2.6 MB
Games/abovehell.swf 2.6 MB
Games/zombieknight.swf 2.6 MB
Games/Raider Episode 2.swf 2.6 MB
Games/Reincarnation Series/Reincarnation The Backfire Of Hell.swf 2.6 MB
Games/afterglow.swf 2.5 MB
Games/g-switch.swf 2.5 MB
Games/Choose Your Weapon Series/Choose Your Weapon 4.swf 2.5 MB
Games/Pretentious Game Series/pretentiousgame3.swf 2.5 MB
Games/lasercannon2.swf 2.5 MB
Games/pyjaman.swf 2.5 MB
Games/Crow in Hell Series/a crow in hell 3.swf 2.5 MB
Games/airbornewars.swf 2.5 MB
Games/catopult.swf 2.5 MB
Games/The Elephant Collection/Achievement Unlocked.swf 2.5 MB
Games/Dibbles Pro Pack.swf 2.5 MB
Games/Tiny Hawk.swf 2.5 MB
Games/blobsstory.swf 2.5 MB
Games/insidia.swf 2.5 MB
Games/Cuboy Series/cuboy quest 2.swf 2.5 MB
Games/air_pressure.swf 2.5 MB
Games/Cuboy Series/cuboy facebutt.swf 2.5 MB
Games/bossslayer.swf 2.5 MB
Games/Submachine Series/Submachine 5 the root.swf 2.5 MB
Games/The great Attic Escape.swf 2.5 MB
Games/spaceiskey2.swf 2.5 MB
Games/BoxHead Series/boxhead more rooms.swf 2.4 MB
Games/Understanding Games Episode 2.swf 2.4 MB
Games/insectonator.swf 2.4 MB
Games/dibblesforthegreatergood.swf 2.4 MB
Games/Armor_Defence.swf 2.4 MB
Games/Spy 2.swf 2.4 MB
Games/defend_your_cabin.swf 2.4 MB
Games/crumpled.swf 2.4 MB
Games/portalquest.swf 2.4 MB
Games/Cube Escape Series/Cube Escape_ Harvey's Box.swf 2.4 MB
Games/kingsrider.swf 2.4 MB
Games/farm_doggie.swf 2.4 MB
Games/Cube Escape Series/Cube Escape_ The Lake.swf 2.4 MB
Games/theadventuresofred.swf 2.4 MB
Games/Feed Us Series/feedushappy.swf 2.4 MB
Games/mouse and guns.swf 2.4 MB
Games/2012shelter.swf 2.4 MB
Games/square_hero_origins.swf 2.4 MB
Games/oilnight.swf 2.4 MB
Games/the_worlds_hardest_game_v_2_0.swf 2.4 MB
Games/trophiends.swf 2.4 MB
Games/asleep walking.swf 2.4 MB
Games/castle cat.swf 2.4 MB
Games/anbot.swf 2.3 MB
Games/Crayon Poke.swf 2.3 MB
Games/Crush_the_castle.swf 2.3 MB
Games/wheniwasyoung.swf 2.3 MB
Games/Sneak Thief Series/Sneak Thief 2.swf 2.3 MB
Games/mirror_runners.swf 2.3 MB
Games/bomb diver.swf 2.3 MB
Games/bamboodino.swf 2.3 MB
Games/Steppenwolf Series/steppenwolf_chapter_6_episode_1.swf 2.3 MB
Games/lancelost.swf 2.3 MB
Games/iq_ball.swf 2.3 MB
Games/soldierdiary.swf 2.3 MB
Games/Sapphire Room Escape.swf 2.3 MB
Games/christmasrunner.swf 2.3 MB
Games/Reincarnation Series/Reincarnation A Hillbilly Holiday.swf 2.3 MB
Games/ClickPLAY series/Clickplay 2.swf 2.3 MB
Games/The Railway Robots Road Trip.swf 2.3 MB
Games/I Remain.swf 2.2 MB
Games/awesome_happy_heroes.swf 2.2 MB
Games/alienbottlebuccaneer.swf 2.2 MB
Games/BLOCnog.swf 2.2 MB
Games/Sift Heads Series/Sift Heads 0.swf 2.2 MB
Games/The Great Basement Escape.swf 2.2 MB
Games/Bummin' A Ride.swf 2.2 MB
Games/Steppenwolf Series/steppenwolf_chapter_6_episode_3.swf 2.2 MB
Games/One Button Bob.swf 2.2 MB
Games/shapefold2.swf 2.2 MB
Games/Understanding Games Episode 3.swf 2.2 MB
Games/adventuresofveronicawright.swf 2.2 MB
Games/simplemotions2.swf 2.2 MB
Games/wasabi.swf 2.2 MB
Games/Reincarnation Series/Reincarnation Bloody Bayou.swf 2.2 MB
Games/wormmadness.swf 2.2 MB
Games/frustrabit.swf 2.2 MB
Games/Ragdoll Cannon Series/ragdollcannonlevelpack.swf 2.2 MB
Games/the sniper.swf 2.2 MB
Games/The Sagittarian Series/The Sagittarian.swf 2.2 MB
Games/the_i_of_it.swf 2.2 MB
Games/Steppenwolf Series/steppenwolf_chapter_6_episode_2.swf 2.2 MB
Games/SAS Zombie Assault.swf 2.1 MB
Games/Quick Quests.swf 2.1 MB
Games/Creative Kill Chamber Two!.swf 2.1 MB
Games/papertrain.swf 2.1 MB
Games/shameless_clone.swf 2.1 MB
Games/miningtruck.swf 2.1 MB
Games/newspaper_boy.swf 2.1 MB
Games/Wake Up the Box Series/wakeupthebox2.swf 2.1 MB
Games/Adventure Al.swf 2.1 MB
Games/60 seconds Santa Run.swf 2.1 MB
Games/The Elephant Collection/Achievement Unlocked 3.swf 2.1 MB
Games/defend your nuts.swf 2.1 MB
Games/defend-your-nuts.swf 2.1 MB
Games/dogfight.swf 2.1 MB
Games/Burger Cat.swf 2.1 MB
Games/zombierumble.swf 2.1 MB
Games/bush royal rampage.swf 2.1 MB
Games/easyjoe2.swf 2.1 MB
Games/creative_kill_chamber.swf 2.1 MB
Games/yo-ho-hocannon.swf 2.1 MB
Games/Steppenwolf Series/steppenwolf_chapter_5_episode_4.swf 2.1 MB
Games/Dog FightThe Ultimate War.swf 2.1 MB
Games/Crop Defenders.swf 2.1 MB
Games/avatar_elemental_escape.swf 2.0 MB
Games/Deadly Venom.swf 2.0 MB
Games/Steppenwolf Series/steppenwolf_chapter_5_episode_2.swf 2.0 MB
Games/Monsterland Series/monsterland. junior vs senior.swf 2.0 MB
Games/Whack Series/whack_your_boss.swf 2.0 MB
Games/kingstory.swf 2.0 MB
Games/Sweet Drmzzz.swf 2.0 MB
Games/holiday_sim.swf 2.0 MB
Games/airbattle.swf 2.0 MB
Games/Adventurous Eric.swf 2.0 MB
Games/fallenfromthemoon.swf 2.0 MB
Games/Ninjufo.swf 2.0 MB
Games/Arcane The Stone Circle Series/Arcane The Stone Circle - Episode 7.swf 2.0 MB
Games/nevermore_2.swf 2.0 MB
Games/the-day.swf 2.0 MB
Games/Infectonator Series/infectonatorwd.swf 2.0 MB
Games/Number Ninjas.swf 2.0 MB
Games/Mutant Alien Assault.swf 2.0 MB
Games/Click The Frog.swf 2.0 MB
Games/tobesgreatescape.swf 2.0 MB
Games/Steppenwolf Series/steppenwolf_chapter_1_episode_3.swf 2.0 MB
Games/bush shoot-out.swf 2.0 MB
Games/farm_express_2.swf 2.0 MB
Games/Looming.swf 1.9 MB
Games/alien hominid.swf 1.9 MB
Games/BoxHead Series/boxhead_2play.swf 1.9 MB
Games/Arcane The Stone Circle Series/Arcane The Stone Circle - Episode 6.swf 1.9 MB
Games/Sift Heads Series/sift_heads_3.swf 1.9 MB
Games/the_power_of_love.swf 1.9 MB
Games/where`re my bunnies.swf 1.9 MB
Games/Shift Series/SHIFT 2.swf 1.9 MB
Games/Steppenwolf Series/steppenwolf_chapter_5_episode_1.swf 1.9 MB
Games/Fireboy & Watergirl Series/fireboy & watergirl in the_forest_temple_3.swf 1.9 MB
Games/Thing-Thing Series/thing-thing_2.swf 1.9 MB
Games/Lucass Quest Backwards.swf 1.9 MB
Games/rocketsanta.swf 1.9 MB
Games/dead_drunk.swf 1.9 MB
Games/rocket santa.swf 1.9 MB
Games/how_to_raise_a_dragon.swf 1.9 MB
Games/gunblood.swf 1.9 MB
Games/abducted.swf 1.9 MB
Games/Arcane The Stone Circle Series/Arcane The Stone Circle - Episode 4.swf 1.9 MB
Games/Steppenwolf Series/steppenwolf_chapter_2_episode_4.swf 1.9 MB
Games/Wake Up the Box Series/wake_up_the_box_4.swf 1.9 MB
Games/the great living room escape.swf 1.9 MB
Games/Crow in Hell Series/a crow in hell 2.swf 1.9 MB
Games/Zombie Invaders.swf 1.9 MB
Games/Menulis.swf 1.9 MB
Games/angelofthebattlefield.swf 1.9 MB
Games/BoxHead Series/boxhead_the_rooms.swf 1.9 MB
Games/angrybee.swf 1.9 MB
Games/Steppenwolf Series/steppenwolf_chapter_5_episode_3.swf 1.9 MB
Games/The Elephant Collection/this-is-the-only-level-too.swf 1.9 MB
Games/Hambo 2 Hambtouchables.swf 1.9 MB
Games/Fireboy & Watergirl Series/fireboy & watergirl in the forest temple.swf 1.9 MB
Games/Despair.swf 1.9 MB
Games/Enigma.swf 1.8 MB
Games/workingstiffs.swf 1.8 MB
Games/Boss Battle.swf 1.8 MB
Games/the miller estate/EPISODE4FIXED.swf 1.8 MB
Games/icarus-needs.swf 1.8 MB
Games/Achilles.swf 1.8 MB
Games/Ninja Glove.swf 1.8 MB
Games/Steppenwolf Series/steppenwolf_chapter_3_episode_1.swf 1.8 MB
Games/Steppenwolf Series/steppenwolf_chapter_4_episode_3.swf 1.8 MB
Games/Up Down Ready.swf 1.8 MB
Games/Steppenwolf Series/steppenwolf_chapter_3_episode_2.swf 1.8 MB
Games/nextplease.swf 1.8 MB
Games/i-saw-her-standing-there.swf 1.8 MB
Games/Steppenwolf Series/steppenwolf_chapter_4_episode_4.swf 1.8 MB
Games/Madness Series/Madness Retaliation.swf 1.8 MB
Games/The Elephant Collection/this-is-the-only-level 3.swf 1.8 MB
Games/no_time_to_explain.swf 1.8 MB
Games/the mechanicer.swf 1.8 MB
Games/Flood Runner Series/the flood runner 2.swf 1.7 MB
Games/Steppenwolf Series/steppenwolf_chapter_4_episode_1.swf 1.7 MB
Games/Parallel Platformer.swf 1.7 MB
Games/accurate_slapshot_level_pack.swf 1.7 MB
Games/Daymare Series/daymare_kite.swf 1.7 MB
Games/Ghostly Me.swf 1.7 MB
Games/The Fancy Pants Adventure World Series/The fancy_pants_adventure_world_1.swf 1.7 MB
Games/Whack Series/whack_your_soul_mate.swf 1.7 MB
Games/flaming_zombooka.swf 1.7 MB
Games/Steppenwolf Series/steppenwolf_chapter_4_episode_2.swf 1.7 MB
Games/Steppenwolf Series/steppenwolf_chapter_1_episode_2.swf 1.7 MB
Games/Daymare Series/DayMare Town 2.swf 1.7 MB
Games/roundworld.swf 1.7 MB
Games/Steppenwolf Series/steppenwolf_chapter_3_episode_3.swf 1.7 MB
Games/zombie_land.swf 1.7 MB
Games/topsyturvy.swf 1.6 MB
Games/Steppenwolf Series/steppenwolf_chapter_2_episode_3.swf 1.6 MB
Games/accurate_slapshot.swf 1.6 MB
Games/Steppenwolf Series/steppenwolf_chapter_2_episode_2.swf 1.6 MB
Games/Steppenwolf Series/steppenwolf_chapter_3_episode_4.swf 1.6 MB
Games/Steppenwolf Series/steppenwolf_chapter_1_episode_4.swf 1.6 MB
Games/Submachine Series/Submachine 1 the basement.swf 1.6 MB
Games/pixelcityskater.swf 1.6 MB
Games/Steppenwolf Series/steppenwolf_chapter_1_episode_1.swf 1.6 MB
Games/Slimey's Quest.swf 1.6 MB
Games/Cat in Japan.swf 1.6 MB
Games/Steppenwolf Series/steppenwolf_chapter_2_episode_1.swf 1.6 MB
Games/onomastica2.swf 1.6 MB
Games/whiterandom.swf 1.6 MB
Games/Mothball Series/mr mothball 5.swf 1.6 MB
Games/Arcane The Stone Circle Series/Arcane The Stone Circle - Episode 1.swf 1.6 MB
Games/Zombie Crypt 3.swf 1.5 MB
Games/the miller estate/the_miller_estate.swf 1.5 MB
Games/gunrox_gang_wars.swf 1.5 MB
Games/Zombie Crypt 2.swf 1.5 MB
Games/40xEscape.swf 1.5 MB
Games/Arcane The Stone Circle Series/Arcane The Stone Circle - Episode 2.swf 1.5 MB
Games/Arcane The Stone Circle Series/Arcane The Stone Circle - Episode 3.swf 1.5 MB
Games/agentturnright.swf 1.5 MB
Games/cursed_winds.swf 1.5 MB
Games/Daymare Series/DayMare Town.swf 1.5 MB
Games/run_1.swf 1.5 MB
Games/Andrew the Droid.swf 1.5 MB
Games/ClueSweeper.swf 1.5 MB
Games/Riddle School Series/riddle_school_2.swf 1.5 MB
Games/Gravity Master.swf 1.5 MB
Games/savethefallen.swf 1.5 MB
Games/Super Stacker 2.swf 1.5 MB
Games/SeppuKuties.swf 1.5 MB
Games/Ragdoll Cannon Series/Ragdoll Cannon 1.5.swf 1.5 MB
Games/orpheus.swf 1.4 MB
Games/5 Differences.swf 1.4 MB
Games/hitthetroll.swf 1.4 MB
Games/smile_pixel.swf 1.4 MB
Games/Arcane The Stone Circle Series/Arcane The Stone Circle - Episode 5.swf 1.4 MB
Games/Hello Worlds!.swf 1.4 MB
Games/superpig.swf 1.4 MB
Games/Submachine Series/Submachine 0 the ancient adventure.swf 1.4 MB
Games/Pretentious Game Series/Pretentious Game 2.swf 1.4 MB
Games/live2work.swf 1.4 MB
Games/isoballx1.swf 1.4 MB
Games/Bloons Series/Bloons Tower Defense 3.swf 1.4 MB
Games/The Square.swf 1.4 MB
Games/screwthenut.swf 1.4 MB
Games/The Great Kitchen Escape.swf 1.4 MB
Games/bravekings.swf 1.4 MB
Games/Splat.swf 1.4 MB
Games/siftx-mess.swf 1.4 MB
Games/gravity duck 2.swf 1.4 MB
Games/Tumble Waiter.swf 1.4 MB
Games/splitterpals.swf 1.4 MB
Games/feedfreddy.swf 1.4 MB
Games/Dusk 2.swf 1.4 MB
Games/fatslice2.swf 1.4 MB
Games/Momentum_master.swf 1.3 MB
Games/dual_color_fairy.swf 1.3 MB
Games/haunted_house.swf 1.3 MB
Games/slime_laboratory_2.swf 1.3 MB
Games/red remover player pack.swf 1.3 MB
Games/slime-laboratory.swf 1.3 MB
Games/Little Fins.swf 1.3 MB
Games/I Was Hungry But There Were Cannons.swf 1.3 MB
Games/The Elephant Collection/This_is_the_only_level.swf 1.3 MB
Games/Nodes.swf 1.3 MB
Games/ending.swf 1.3 MB
Games/hole_in_the_wall_-_twisted_figures.swf 1.3 MB
Games/letitslide.swf 1.3 MB
Games/Ragdoll Cannon Series/Ragdoll Cannon Remake.swf 1.3 MB
Games/down_is_up.swf 1.3 MB
Games/SOPAPIPA.swf 1.3 MB
Games/dudeandzombies.swf 1.3 MB
Games/agent-b10-2.swf 1.3 MB
Games/pigscanfly.swf 1.3 MB
Games/unperfect.swf 1.3 MB
Games/Crow in Hell Series/a crow in hell.swf 1.3 MB
Games/Reincarnation Series/Reincarnation Out to Sea You Die.swf 1.3 MB
Games/Nightmares The Adventures Series/nightmares_the adventures 2 - Who Wants To Frame Hairy De Bully.swf 1.3 MB
Games/Darkness 2.swf 1.3 MB
Games/zombie_crypt.swf 1.3 MB
Games/Alien Exterminator.swf 1.3 MB
Games/DUI.swf 1.3 MB
Games/stealth_hunter.swf 1.3 MB
Games/floodfill.swf 1.2 MB
Games/Whack Series/whack_your_pc.swf 1.2 MB
Games/Wizard's Run.swf 1.2 MB
Games/splitman.swf 1.2 MB
Games/Nightmares The Adventures Series/nightmares_the_adventures_3_the_baron_of_vermin_famine.swf 1.2 MB
Games/Aequilibrium Series/Aequilibrium.swf 1.2 MB
Games/Water Werks.swf 1.2 MB
Games/Where is series/where_is_2014.swf 1.2 MB
Games/gingerbread_circus.swf 1.2 MB
Games/Where is series/Where is 2010.swf 1.2 MB
Games/coign of vantage.swf 1.2 MB
Games/Nightmares The Adventures Series/nightmares_the_adventures_1_broken_bones_complaint.swf 1.2 MB
Games/Escher.swf 1.2 MB
Games/stackopolis.swf 1.2 MB
Games/missingmechanism.swf 1.2 MB
Games/outlawjack.swf 1.2 MB
Games/Sky Island.swf 1.2 MB
Games/catsastronauts.swf 1.2 MB
Games/pixelquest.swf 1.2 MB
Games/alienfamily.swf 1.2 MB
Games/doors2.swf 1.2 MB
Games/gluey2.swf 1.2 MB
Games/nob_war_the_elves.swf 1.2 MB
Games/Super Crazy Guitar Maniac Deluxe Series/super_crazy_guitar_maniac_deluxe.swf 1.2 MB
Games/Ricochet Kills Series/ricochet kills players pack.swf 1.2 MB
Games/princess_rescue.swf 1.2 MB
Games/candyconveyor.swf 1.2 MB
Games/Zombie Crypt.swf 1.2 MB
Games/gravitypop.swf 1.2 MB
Games/Ricochet Kills Series/Ricochet Kills 2.swf 1.2 MB
Games/jellycannon.swf 1.2 MB
Games/Ballooner New Adventures.swf 1.2 MB
Games/Sprout.swf 1.2 MB
Games/colliderix.swf 1.2 MB
Games/Ballooner.swf 1.1 MB
Games/The Great Minimum.swf 1.1 MB
Games/Pieces.swf 1.1 MB
Games/redremoverplayerpack2.swf 1.1 MB
Games/Gravity Duck.swf 1.1 MB
Games/littlesheep.swf 1.1 MB
Games/redremover.swf 1.1 MB
Games/agent-b10.swf 1.1 MB
Games/Sugar, Sugar 3.swf 1.1 MB
Games/thanksforplaying.swf 1.1 MB
Games/Pretentious Game Series/pretentiousgame.swf 1.1 MB
Games/koutack.swf 1.1 MB
Games/rabbitwantscake.swf 1.1 MB
Games/Go Usagi Go.swf 1.1 MB
Games/humbug.swf 1.1 MB
Games/alienskidnappedbetty.swf 1.1 MB
Games/shapefold.swf 1.1 MB
Games/Hanna in a Choppa.swf 1.1 MB
Games/morphing.swf 1.1 MB
Games/castle cat 2.swf 1.0 MB
Games/Infectonator Series/infectonator_xmas.swf 1.0 MB
Games/albertthealien.swf 1.0 MB
Games/doors 3 - locked out.swf 1.0 MB
Games/Shift Series/SHIFT 3.swf 1.0 MB
Games/the miller estate/the_miller_estate_2.swf 1.0 MB
Games/werebox.swf 1.0 MB
Games/N game.swf 1.0 MB
Games/spaceiskey.swf 1.0 MB
Games/govirus.swf 1.0 MB
Games/smokinbarrels.swf 1.0 MB
Games/friendlywormholes.swf 1.0 MB
Games/Numz.swf 1.0 MB
Games/treasure_of_cutlass_reef.swf 998.2 kB
Games/Chromatic.swf 997.2 kB
Games/dupligon.swf 997.1 kB
Games/go go plant.swf 994.4 kB
Games/easyjoe3.swf 993.8 kB
Games/Pyro.swf 991.0 kB
Games/Ragdoll Cannon Series/ragdollcannon.swf 989.4 kB
Games/Rotate & Roll Players Pack.swf 985.9 kB
Games/Aequilibrium Series/Aequilibrium 4.swf 981.5 kB
Games/superstrikeofrage.swf 977.6 kB
Games/Gangster Bros.swf 976.3 kB
Games/Mothball Series/mr mothball 2.swf 974.0 kB
Games/ClickPLAY series/clickplaytime-3.swf 973.7 kB
Games/chess_strategy.swf 973.3 kB
Games/escape_the_phone_booth.swf 972.7 kB
Games/StarShine 2.swf 971.0 kB
Games/Ghosts Stole My Puppy.swf 965.5 kB
Games/The Elephant Collection/Obey the Game.swf 961.4 kB
Games/zabaax.swf 960.4 kB
Games/briker.swf 959.7 kB
Games/hack_slash_crawl.swf 959.4 kB
Games/Survivor115.swf 958.0 kB
Games/Where is series/where_is_2009.swf 957.0 kB
Games/monster_mowdown.swf 954.9 kB
Games/doors - daves free lessons.swf 953.1 kB
Games/Panda Star.swf 951.2 kB
Games/colortheory.swf 950.4 kB
Games/lostars.swf 949.1 kB
Games/dark_cut.swf 948.7 kB
Games/ninja_rampage.swf 947.9 kB
Games/the miller estate/EPISODE3.swf 946.9 kB
Games/burglar_hunt.swf 946.9 kB
Games/Mothball Series/mr mothball.swf 946.2 kB
Games/mega_miner.swf 946.0 kB
Games/Rotate & Roll.swf 933.3 kB
Games/nevermore.swf 931.8 kB
Games/higher.swf 925.0 kB
Games/divide.swf 924.3 kB
Games/peterthepenguin.swf 924.2 kB
Games/lightmyfire.swf 923.2 kB
Games/prince_and_princess_elope.swf 920.0 kB
Games/Tactics 100 Live.swf 919.7 kB
Games/mustescapetheisland.swf 919.0 kB
Games/bounzy.swf 913.9 kB
Games/run_2.swf 912.4 kB
Games/Sugar_Sugar_2.swf 911.6 kB
Games/easyjoe4.swf 910.4 kB
Games/simplemotions.swf 909.4 kB
Games/The Majesty of Colors.swf 908.6 kB
Games/littleloki.swf 897.9 kB
Games/ClickPLAY series/ClickPLAY!.swf 886.3 kB
Games/sugar_sugar.swf 880.7 kB
Games/Hitstick Series/Hitstick. Silence is over.swf 879.7 kB
Games/learn_to_fly.swf 874.3 kB
Games/Dojo of Death.swf 844.7 kB
Games/Wake Up the Box Series/wakeupthebox.swf 844.5 kB
Games/Spy.swf 812.8 kB
Games/Discovery.swf 808.7 kB
Games/hambo.swf 803.7 kB
Games/Aequilibrium Series/aequilibrium3.swf 802.7 kB
Games/easyjoe.swf 802.4 kB
Games/Bloons Series/Bloons Tower Defense 2.swf 785.9 kB
Games/Aequilibrium Series/Aequilibrium2.swf 776.9 kB
Games/Ricochet Kills Series/Ricochet Kills.swf 765.3 kB
Games/Cuboy Series/Cuboy Quest.swf 762.2 kB
Games/Take Something Literally 2.swf 759.3 kB
Games/Infectonator Series/infectonator.swf 750.3 kB
Games/Color Carnage.swf 748.3 kB
Games/Zombie Bites.swf 746.6 kB
Games/the_worlds_hardest_game.swf 744.1 kB
Games/Shadez The Black Operations.swf 708.7 kB
Games/onomastica.swf 703.6 kB
Games/I wish I were the Moon.swf 696.2 kB
Games/BoxHead Series/Boxhead - A Halloween Special.swf 693.4 kB
Games/Ricochet Kills Series/ricochet war.swf 690.2 kB
Games/Mothball Series/mr mothball 4.swf 681.0 kB
Games/Bloons Series/Bloons Pop Three.swf 659.9 kB
Games/Bongo Boom Battlegrounds.swf 648.0 kB
Games/Thing-Thing Series/Thing-Thing.swf 641.5 kB
Games/Riddle School Series/riddle_school.swf 627.6 kB
Games/Bazooka Boy Series/Bazooka Boy.swf 615.5 kB
Games/Bazooka Boy Series/Bazooka Boy Level Pack.swf 614.9 kB
Games/Doors. Out of office.swf 610.2 kB
Games/Talesworth Adventure Ep. 1.swf 589.5 kB
Games/The irRegularGame of Life.swf 582.2 kB
Games/a duck has an adventure.swf 575.5 kB
Games/Clockwork Cat.swf 555.1 kB
Games/And Everything Started to Fall.swf 537.4 kB
Games/Nano Ninja.swf 535.0 kB
Games/Bloons Series/Bloons Tower Defense.swf 530.8 kB
Games/Bloons Series/Bloons.swf 522.0 kB
Games/Bloons Series/bloons_player_pack_2.swf 518.6 kB
Games/Bloons Series/bloons_player_pack_1.swf 512.5 kB
Games/Flood Runner Series/the Flood Runner.swf 461.0 kB
Games/Bloons Series/Bloons Player Pack 5.swf 452.1 kB
Games/Bloons Series/Bloons Player Pack 4.swf 435.0 kB
Games/the miller estate/INTRODUCTION.swf 430.9 kB
Games/TETRIS'D The Game.swf 427.5 kB
Games/Blosics.swf 413.5 kB
Games/starshine.swf 378.2 kB
Games/Take Something Literally.swf 366.1 kB
Games/Mothball Series/mr mothball 3.swf 345.1 kB
Games/Fat Slice.swf 283.1 kB
Games/Daymare Series/Daymare Invaders.swf 282.9 kB
Games/Shift Series/SHIFT.swf 244.3 kB
Games/Vox Populi Vox Dei(a werewolf thriller).swf 235.0 kB
Games/Monster Match.swf 168.3 kB
Games/Tealy Orangey.swf 141.3 kB
Games/Orbox B.swf 84.4 kB
Games/Game in Ten Seconds.swf 70.8 kB
Games/faze.swf 67.5 kB
Games/The Linear RPG.swf 65.5 kB
Games/loops of zen.swf 36.5 kB
Games/Bouboum.swf 17.0 kB

Cool.Flash.Games

磁力链接/BT种子名称

磁力链接/BT种子简介

移花宫入口

磁力链接下载

下载BT种子文件

最近搜索

文件列表

随机展示

相关说明